# Test data in notation3 http://www.w3.org/DesignIssues/Notation3.html # @prefix affx: . @prefix rdfs: . @prefix owl: . @prefix : <#> . affx:Gene a owl:Class ; owl:hasProperty affx:onStrand ; owl:hasProperty affx:onChr ; owl:hasProperty affx:hasVariant . affx:onStrand a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The strand on which the gene exists" . affx:onChr a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The chromosome on which the gene exists" . affx:hasVariant a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range affx:SpliceVariant ; owl:minCardinality "1" ; rdfs:comment "For associating variants to genes" . affx:SpliceVariant a owl:Class ; owl:hasProperty affx:representedBy . affx:representedBy a owl:ObjectProperty ; owl:domain affx:SpliceVariant ; owl:range affx:Transcript ; owl:minCardinality "1" ; rdfs:comment "In this data, each splice variant is represented by one transcript" . affx:Transcript a owl:Class ; owl:hasProperty affx:unigene ; owl:hasProperty affx:translatesTo ; owl:hasProperty affx:fullCds ; owl:hasProperty affx:hasExon ; owl:hasProperty affx:signalPHit ; owl:hasProperty affx:tmHMMHit ; rdfs:comment "A transcript has a CDS region, a protein translation, and exons" ; rdfs:comment "Additionally the transcript might have one or more annotations" . affx:unigene a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The Unigene ID of the transcript - and splice variant" . affx:translatesTo a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The amino acid sequence derived from the transcript" . affx:fullCds a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:GenomicCoordinates ; owl:cardinality "1" ; rdfs:comment "Start and stop coordinates of the full CDS region" . affx:hasExon a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:ExonPlusCds ; owl:minCardinality "1" ; rdfs:comment "Here, exons are defined only by their coordinates " . affx:ExonPlusCds a owl:Class ; owl:hasProperty affx:relatesToExon ; owl:hasProperty affx:cdsType ; owl:hasProperty affx:cdsStart ; owl:hasProperty affx:cdsStop ; owl:hasProperty affx:frame . affx:relatesToExon a owl:ObjectProperty ; owl:domain affx:ExonWithCds ; owl:range affx:Exon ; owl:cardinality "1" ; rdfs:comment "For associating exons with properties such as frame" . affx:Exon a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:commonToAll ; rdfs:comment "Defines the coordinates of an exon on the genome" . affx:GenomicSpan a owl:Class ; rdfs:subClassOf affx:GenomicCoordinates ; rdfs:comment "This defines a region of _ungapped_ genomic alignment" . affx:GenomicCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Start and stop, possibly with intervening gaps " ; rdfs:comment "Strand and chr will be specified at the gene level " . affx:Coordinates a owl:Class ; owl:hasProperty affx:startsAt ; owl:hasProperty affx:stopsAt . affx:startsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:stopsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:cdsType a owl:ObjectProperty ; owl:domain affx:ExonPlusCds ; owl:range rdfs:Literal ; rdfs:comment "Expected CDS types are Full, Partial, and None" . affx:commonToAll a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Shows if all the gene's variants share this object" . affx:CdsOccupancy a owl:Class ; rdfs:subClassOf rdfs:Literal . affx:cdsStart a owl:ObjectProperty ; rdfs:subClassOf affx:startsAt ; rdfs:comment "For indicating where a specific CDS region starts" . affx:cdsStop a owl:ObjectProperty ; rdfs:subClassOf affx:stopsAt ; rdfs:comment "For indicating where a specific CDS region stops" . affx:frame a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" . affx:signalPHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:SignalPeptide ; owl:cardinality "1" . affx:SignalPeptide a owl:Class ; rdfs:subClassOf affx:Annotation ; rdfs:comment "Represents a SIGNALP hit" . affx:tmHMMHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:Transmembrane ; owl:cardinality "1" . affx:Transmembrane a owl:Class ; rdfs:subClassOf affx:Annotation ; owl:hasProperty affx:helixCount ; rdfs:comment "Represents a TMHMM hit" . affx:Annotation a owl:Class ; owl:hasProperty affx:containsMotif; owl:hasProperty affx:commonToAll ; owl:hasProperty affx:motifCount . affx:containsMotif a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range affx:Motif ; owl:minCardinality "1" . affx:motifCount a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Number of motifs (eg. TM passes) in this annotation" . affx:Motif a owl:Class ; owl:hasProperty affx:hasProteinSpan . affx:hasProteinSpan a owl:ObjectProperty ; owl:domain affx:Motif ; owl:range affx:ProteinSpan . affx:ProteinCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Coordinates onto the protein sequence, possibly gapped ". affx:spannedBy a owl:ObjectProperty ; owl:domain affx:ProteinSpan ; owl:range affx:CdsSpan ; owl:minCardinality "1" . affx:ProteinSpan a owl:Class ; rdfs:subClassOf affx:ProteinCoordinates ; owl:hasProperty affx:spannedBy ; rdfs:comment "An ungapped region of the protein sequence " ; rdfs:comment "Each ProteinSpan as one or more corresponding CDS span" . affx:CdsSpan a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:inFrame ; rdfs:comment "A CDS span is a genomic span with a translation frame" ; rdfs:comment "Each CDS span describes a part of the full CDS region" . :Gene1 a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi9887088] ; affx:hasVariant [affx:representedBy :gi9887090] . :gi9887088 a affx:Transcript ; affx:unigene "iMm.79224" ; affx:translatesTo "MAVSRAPAPDSACQRMVWLFPLVFCLGSGSEVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWNAVWFMTTISIISAVILIFVCWSIHVWKRRGSLPLTSQHPESSQSTDGPGSPGNTVYAQVTRPMQEMKIPKPIKNDSMTIYSIVNHSREAEYS" ; affx:hasCds [affx:startsAt "173200854" ; affx:stopsAt "173225622" ]; affx:hasExon [ affx:relatesToExon :Gene1_e2; affx:cdsType "Partial" ; affx:cdsStart "173200854" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene1_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene1_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene1_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene1_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene1_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene1_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene1_e9; affx:cdsType "Partial" ; affx:cdsStop "173225622" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "30" ; affx:spannedBy [ affx:startsAt "173200854" ; affx:stopsAt "173200939" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "173217128" ; affx:stopsAt "173217133" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "240" ; affx:stopsAt "262" ; affx:spannedBy [ affx:startsAt "173221060" ; affx:stopsAt "173221126" ; affx:inFrame "2" ] ; ] ; ] ; . :gi9887090 a affx:Transcript ; affx:unigene "iMm.79224" ; affx:translatesTo "MAVSRAPAPDSACQRMVWLFPLVFCLGSGSEVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWNAVWFMTTISIISAVILIFVCWSIHVWKRRGSLPLTSQHPESSQSTDGPGSPGNTVYAQVTRPMQEMKIPKPIKNDSMTIYSIVNHSREETVALTGYNQPITLKVNTLINYNS" ; affx:hasCds [affx:startsAt "173200854" ; affx:stopsAt "173231103" ]; affx:hasExon [ affx:relatesToExon :Gene1_e1; affx:cdsType "Partial" ; affx:cdsStart "173200854" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene1_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene1_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene1_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene1_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene1_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene1_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene1_e10; affx:cdsType "Partial" ; affx:cdsStop "173231103" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene1_e11; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "30" ; affx:spannedBy [ affx:startsAt "173200854" ; affx:stopsAt "173200939" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "173217128" ; affx:stopsAt "173217133" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "240" ; affx:stopsAt "262" ; affx:spannedBy [ affx:startsAt "173221060" ; affx:stopsAt "173221126" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene1_e1 a affx:Exon ; affx:startsAt "173200661" ; affx:stopsAt "173200939" ; affx:commonToAll "0" . :Gene1_e2 a affx:Exon ; affx:startsAt "173200683" ; affx:stopsAt "173200939" ; affx:commonToAll "0" . :Gene1_e3 a affx:Exon ; affx:startsAt "173217128" ; affx:stopsAt "173217470" ; affx:commonToAll "1" . :Gene1_e4 a affx:Exon ; affx:startsAt "173219498" ; affx:stopsAt "173219762" ; affx:commonToAll "1" . :Gene1_e5 a affx:Exon ; affx:startsAt "173221031" ; affx:stopsAt "173221145" ; affx:commonToAll "1" . :Gene1_e6 a affx:Exon ; affx:startsAt "173221481" ; affx:stopsAt "173221511" ; affx:commonToAll "1" . :Gene1_e7 a affx:Exon ; affx:startsAt "173222425" ; affx:stopsAt "173222499" ; affx:commonToAll "1" . :Gene1_e8 a affx:Exon ; affx:startsAt "173224654" ; affx:stopsAt "173224726" ; affx:commonToAll "1" . :Gene1_e9 a affx:Exon ; affx:startsAt "173225607" ; affx:stopsAt "173226898" ; affx:commonToAll "0" . :Gene1_e10 a affx:Exon ; affx:startsAt "173231028" ; affx:stopsAt "173231105" ; affx:commonToAll "0" . :Gene1_e11 a affx:Exon ; affx:startsAt "173231722" ; affx:stopsAt "173231982" ; affx:commonToAll "0" . :Gene2 a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi14028703] ; affx:hasVariant [affx:representedBy :gi16716386] . :gi14028703 a affx:Transcript ; affx:unigene "iMm.196691" ; affx:translatesTo "MLTEPAQLFVHKKNQPPSHSSLRLHFRTLAGALALSSTQMSWGLQILPCLSLILLLWNQVPGLEGQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL" ; affx:hasCds [affx:startsAt "131714646" ; affx:stopsAt "131719531" ]; affx:hasExon [ affx:relatesToExon :Gene2_e2; affx:cdsType "Partial" ; affx:cdsStart "131714646" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2_e8; affx:cdsType "Full" ; affx:frame "0"] ; . :gi16716386 a affx:Transcript ; affx:unigene "iMm.196691" ; affx:translatesTo "MSWGLQILPCLSLILLLWNQVPGLEGQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL" ; affx:hasCds [affx:startsAt "131714646" ; affx:stopsAt "131717933" ]; affx:hasExon [ affx:relatesToExon :Gene2_e1; affx:cdsType "Partial" ; affx:cdsStart "131714646" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2_e7; affx:cdsType "Partial" ; affx:cdsStop "131717933" ; affx:frame "2"] ; . :Gene2_e1 a affx:Exon ; affx:startsAt "131714265" ; affx:stopsAt "131714730" ; affx:commonToAll "0" . :Gene2_e2 a affx:Exon ; affx:startsAt "131714631" ; affx:stopsAt "131714730" ; affx:commonToAll "0" . :Gene2_e3 a affx:Exon ; affx:startsAt "131715525" ; affx:stopsAt "131715600" ; affx:commonToAll "1" . :Gene2_e4 a affx:Exon ; affx:startsAt "131716025" ; affx:stopsAt "131716184" ; affx:commonToAll "1" . :Gene2_e5 a affx:Exon ; affx:startsAt "131716979" ; affx:stopsAt "131717042" ; affx:commonToAll "1" . :Gene2_e6 a affx:Exon ; affx:startsAt "131717768" ; affx:stopsAt "131717962" ; affx:commonToAll "0" . :Gene2_e7 a affx:Exon ; affx:startsAt "131717768" ; affx:stopsAt "131718188" ; affx:commonToAll "0" . :Gene2_e8 a affx:Exon ; affx:startsAt "131719443" ; affx:stopsAt "131719531" ; affx:commonToAll "0" . :Prelp a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi16905108] ; affx:hasVariant [affx:representedBy :gi18043602] . :gi16905108 a affx:Transcript ; affx:unigene "iMm.214514" ; affx:translatesTo "MRASFFWLLPLLLILASVAQGQPTRPKPGIRRKPKPRPTPRFPQAPEPAEPTDLPPPLPPGPPSVFPDCPRECYCPPDFPSALYCDSRNLRRVPVIPPRIHYLYLQNNFITELPLESFQNATGLRWVNLDNNRIRKVDQRVLGKLPSLAFLYMEKNQLEEVPSALPRNLEQLRLSQNLISRIPPGVFSKLENLLLLDLQHNRLSDGVFKADTFQGLKNLMQLNLAHNILRKMPPKVPQAIHQLYLDSNKIETIPNGYFKDFPNLAFIRMNYNKLSDRGLPKNSFNISNLLVLHLSHNKISNVPAISNKLEHLYLNNNSIEKINGTQICPNNLVAFHDFSSDLENVPHLRYLRLDGNFLKPPIPLDLMMCFRLLQSVVI" ; affx:hasCds [affx:startsAt "134777562" ; affx:stopsAt "134780347" ]; affx:hasExon [ affx:relatesToExon :Prelp_e2; affx:cdsType "Partial" ; affx:cdsStart "134777562" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Prelp_e3; affx:cdsType "Partial" ; affx:cdsStop "134780013" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Prelp_e5; affx:cdsType "None" ] ; . :gi18043602 a affx:Transcript ; affx:unigene "iMm.214514" ; affx:translatesTo "MRASFFWLLPLLLILASVAQGQPTRPKPGIRRKPKPRPTPRFPQAPEPAEPTDLPPPLPPGPPSVFPDCPRECYCPPDFPSALYCDSRNLRRVPVIPPRIHYLYLQNNFITELPLESFQNATGLRWVNLDNNRIRKVDQRVLGKLPSLAFLYMEKNQLEEVPSALPRNLEQLRLSQNLISRIPPGVFSKLENLLLLDLQHNRLSDGVFKADTFQGLKNLMQLNLAHNILRKMPPKVPQAIHQLYLDSNKIETIPNGYFKDFPNLAFIRMNYNKLSDRGLPKNSFNISNLLVLHLSHNKISNVPAISNKLEHLYLNNNSIEKINGTQICPNNLVAFHDFSSDLENVPHLRYLRLDGNFLKPPIPLDLMMCFRLLQSVVI" ; affx:hasCds [affx:startsAt "134777562" ; affx:stopsAt "134780347" ]; affx:hasExon [ affx:relatesToExon :Prelp_e1; affx:cdsType "Partial" ; affx:cdsStart "134777562" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Prelp_e3; affx:cdsType "Partial" ; affx:cdsStop "134780014" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Prelp_e4; affx:cdsType "None" ] ; . :Prelp_e1 a affx:Exon ; affx:startsAt "134775260" ; affx:stopsAt "134777738" ; affx:commonToAll "0" . :Prelp_e2 a affx:Exon ; affx:startsAt "134777368" ; affx:stopsAt "134777738" ; affx:commonToAll "0" . :Prelp_e3 a affx:Exon ; affx:startsAt "134779385" ; affx:stopsAt "134780363" ; affx:commonToAll "1" . :Prelp_e4 a affx:Exon ; affx:startsAt "134786196" ; affx:stopsAt "134786319" ; affx:commonToAll "0" . :Prelp_e5 a affx:Exon ; affx:startsAt "134786196" ; affx:stopsAt "134786344" ; affx:commonToAll "0" . :Kdel1 a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi12963766] ; affx:hasVariant [affx:representedBy :gi18606234] . :gi12963766 a affx:Transcript ; affx:unigene "iMm.8282" ; affx:translatesTo "MFSISLLSCLFLGTVPALAQTGGERRLSPEKSEIWGPGLKAHVVLPARYFYIRAVDTSGEQFTSSPGEKVFQVKISAPDEQFTRVGVQVLDRKDGSFIVRYRMYASYRNLKIEVKHHGQHVAESPYVLRGPVYHENCDCPLEDSAAWLREMNCSETISQIQKDLAHFPTVDPEKIAAEIPKRFGQRQSLCHYTLKDNKVYIKTHGEHVGFRIFMDAILLSLTRKVRMPDVEFFVNLGDWPLEKKKSNSNIQPIFSWCGSTESRDIVMPTYDLTDSVLETMGRVSLDMMSVQANTGPPWESKNSTAVWRGRDSRKERLELVKLSRKHPELIDAAFTNFFFFKHDESLYGPIVKHISFFDFFKHKYQINIDGTVAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKSNLSDLLEKLKWAKEHDAEAKKIAKAGQEFARNNLMGDDIFCYYFKLFQGYANLQVSEPQIREGMKRVEPQSEDDLFPCTCHRRKAKDEL" ; affx:hasCds [affx:startsAt "44646991" ; affx:stopsAt "44658404" ]; affx:hasExon [ affx:relatesToExon :Kdel1_e2; affx:cdsType "Partial" ; affx:cdsStart "44646991" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e13; affx:cdsType "Partial" ; affx:cdsStop "44658404" ; affx:frame "1"] ; . :gi18606234 a affx:Transcript ; affx:unigene "iMm.8282" ; affx:translatesTo "MFSISLLSCLFLGTVPALAQTGGERRLSPEKSEIWGPGLKAHVVLPARYFYIRAVDTSGEQFTSSPGEKVFQVKISAPDEQFTRVGVQVLDRKDGSFIVRYRMYASYRNLKIEVKHHGQHVAESPYVLRGPVYHENCDCPLEDSAAWLREMNCSETISQIQKDLAHFPTVDPEKIAAEIPKRFGQRQSLCHYTLKDNKVYIKTHGEHVGFRIFMDAILLSLTRKVRMPDVEFFVNLGDWPLEKKKSNSNIQPIFSWCGSTESRDIVMPTYDLTDSVLETMGR" ; affx:hasCds [affx:startsAt "44652903" ; affx:stopsAt "44658404" ]; affx:hasExon [ affx:relatesToExon :Kdel1_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Kdel1_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Kdel1_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Kdel1_e6; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Kdel1_e8; affx:cdsType "Partial" ; affx:cdsStart "44652903" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kdel1_e14; affx:cdsType "Partial" ; affx:cdsStop "44658404" ; affx:frame "1"] ; . :Kdel1_e1 a affx:Exon ; affx:startsAt "44646789" ; affx:stopsAt "44647009" ; affx:commonToAll "0" . :Kdel1_e2 a affx:Exon ; affx:startsAt "44646955" ; affx:stopsAt "44647009" ; affx:commonToAll "0" . :Kdel1_e3 a affx:Exon ; affx:startsAt "44647669" ; affx:stopsAt "44647776" ; affx:commonToAll "0" . :Kdel1_e4 a affx:Exon ; affx:startsAt "44647669" ; affx:stopsAt "44647777" ; affx:commonToAll "0" . :Kdel1_e5 a affx:Exon ; affx:startsAt "44649898" ; affx:stopsAt "44649988" ; affx:commonToAll "1" . :Kdel1_e6 a affx:Exon ; affx:startsAt "44650639" ; affx:stopsAt "44650849" ; affx:commonToAll "1" . :Kdel1_e7 a affx:Exon ; affx:startsAt "44652549" ; affx:stopsAt "44652787" ; affx:commonToAll "0" . :Kdel1_e8 a affx:Exon ; affx:startsAt "44652549" ; affx:stopsAt "44653080" ; affx:commonToAll "0" . :Kdel1_e9 a affx:Exon ; affx:startsAt "44652907" ; affx:stopsAt "44653080" ; affx:commonToAll "0" . :Kdel1_e10 a affx:Exon ; affx:startsAt "44654345" ; affx:stopsAt "44654423" ; affx:commonToAll "1" . :Kdel1_e11 a affx:Exon ; affx:startsAt "44654598" ; affx:stopsAt "44654804" ; affx:commonToAll "1" . :Kdel1_e12 a affx:Exon ; affx:startsAt "44656942" ; affx:stopsAt "44657148" ; affx:commonToAll "1" . :Kdel1_e13 a affx:Exon ; affx:startsAt "44658222" ; affx:stopsAt "44658440" ; affx:commonToAll "0" . :Kdel1_e14 a affx:Exon ; affx:startsAt "44658222" ; affx:stopsAt "44658658" ; affx:commonToAll "0" . :4930413O22Rik a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi13385979] ; affx:hasVariant [affx:representedBy :gi18043909] . :gi13385979 a affx:Transcript ; affx:unigene "iMm.45963" ; affx:translatesTo "MADSLDEFIEEQKAKLAKDKAELESDPPYMEMKGKASEKLSENSKILISMAKENIPPSSQQQPKGPLGIEYGLSLPLGEDYEQKKHKLKEELRQDYRRYLTQKNFLSTGETDPSTLGVSLPIDERLSAKERLKLERNREYNQFLRGKAESTEKVRQVEKNIEPKSQRNKNPISQGKSDLPLQIQTAYTHSEGPWLSRQEEGLYRQLDGEIELRSRRPLKQTKEEVGISGAEHPSLSGSAGVPERRARRANGERVLDRQHCRADRDPGVSEDMDERFRFESDFDRRLLRVYTNGRYLHLHFSSLYLLNTGVL" ; affx:hasCds [affx:startsAt "10098545" ; affx:stopsAt "10120466" ]; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e3; affx:cdsType "Partial" ; affx:cdsStart "10098545" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e9; affx:cdsType "Partial" ; affx:cdsStop "10120466" ; affx:frame "2"] ; . :gi18043909 a affx:Transcript ; affx:unigene "iMm.45963" ; affx:translatesTo "MADSLDEFIEEQKAKLAKDKAELESDPPYMEMKGKASEKLSENSKILISMAKENIPPSSQQQPKGPLGIEYGLSLPLGEDYEQKKHKLKEELRQDYRRYLTQKNFLSTGETDPSTLGVSLPIDERLSAKERLKLERNREYNQFLRGKAESTEKVRQVEKNIEPKSQRNKNPISQGKSDLPLQIQTAYTHSEGPWLSRQEEGLYRQLDGEIELRSRRPLKQTKEEVGISGAEHPSLSGSAGVPERRARRANGERVLDRQHCRADRDPGVSEDMDERFRFESDFDRRLLRVYTNGRYLHLHFSSLYLLNTGVL" ; affx:hasCds [affx:startsAt "10098545" ; affx:stopsAt "10120466" ]; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e3; affx:cdsType "Partial" ; affx:cdsStart "10098545" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :4930413O22Rik_e8; affx:cdsType "Partial" ; affx:cdsStop "10120466" ; affx:frame "2"] ; . :4930413O22Rik_e1 a affx:Exon ; affx:startsAt "10091596" ; affx:stopsAt "10091679" ; affx:commonToAll "0" . :4930413O22Rik_e2 a affx:Exon ; affx:startsAt "10093126" ; affx:stopsAt "10093222" ; affx:commonToAll "0" . :4930413O22Rik_e3 a affx:Exon ; affx:startsAt "10098535" ; affx:stopsAt "10098644" ; affx:commonToAll "1" . :4930413O22Rik_e4 a affx:Exon ; affx:startsAt "10100883" ; affx:stopsAt "10100986" ; affx:commonToAll "1" . :4930413O22Rik_e5 a affx:Exon ; affx:startsAt "10112310" ; affx:stopsAt "10112414" ; affx:commonToAll "1" . :4930413O22Rik_e6 a affx:Exon ; affx:startsAt "10117923" ; affx:stopsAt "10118004" ; affx:commonToAll "1" . :4930413O22Rik_e7 a affx:Exon ; affx:startsAt "10118913" ; affx:stopsAt "10119012" ; affx:commonToAll "1" . :4930413O22Rik_e8 a affx:Exon ; affx:startsAt "10120016" ; affx:stopsAt "10120709" ; affx:commonToAll "0" . :4930413O22Rik_e9 a affx:Exon ; affx:startsAt "10120016" ; affx:stopsAt "10121567" ; affx:commonToAll "0" . :Gene6 a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi192488] ; affx:hasVariant [affx:representedBy :gi192508] ; affx:hasVariant [affx:representedBy :gi556326] . :gi192488 a affx:Transcript ; affx:unigene "iMm.1224" ; affx:translatesTo "MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDGILFIYGVIITALYLRAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQDSHFQAVQFGNRREREGSELTRTLGLRARPKGESTQQSSQSCASVFSIPTLWSPWPPSSSSQL" ; affx:hasCds [affx:startsAt "166982870" ; affx:stopsAt "167061934" ]; affx:hasExon [ affx:relatesToExon :Gene6_e2; affx:cdsType "Partial" ; affx:cdsStart "166982870" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene6_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene6_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene6_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e13; affx:cdsType "Partial" ; affx:cdsStop "167061934" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "21" ; affx:spannedBy [ affx:startsAt "166982870" ; affx:stopsAt "166982928" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "167049328" ; affx:stopsAt "167049333" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "31" ; affx:stopsAt "53" ; affx:spannedBy [ affx:startsAt "167049363" ; affx:stopsAt "167049429" ; affx:inFrame "0" ] ; ] ; ] ; . :gi192508 a affx:Transcript ; affx:unigene "iMm.1224" ; affx:translatesTo "MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDGILFIYGVIITALYLRAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQDSHFQAVQFGNRREREGSELTRTLGLRARPKACRHKKPLSLPAAVS" ; affx:hasCds [affx:startsAt "166982870" ; affx:stopsAt "167064213" ]; affx:hasExon [ affx:relatesToExon :Gene6_e3; affx:cdsType "Partial" ; affx:cdsStart "166982870" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene6_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene6_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene6_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene6_e14; affx:cdsType "Partial" ; affx:cdsStop "167064213" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "21" ; affx:spannedBy [ affx:startsAt "166982870" ; affx:stopsAt "166982928" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "167049328" ; affx:stopsAt "167049333" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "31" ; affx:stopsAt "53" ; affx:spannedBy [ affx:startsAt "167049363" ; affx:stopsAt "167049429" ; affx:inFrame "0" ] ; ] ; ] ; . :gi556326 a affx:Transcript ; affx:unigene "iMm.1224" ; affx:translatesTo "MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDGILFIYGVIITALYLRAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR" ; affx:hasCds [affx:startsAt "166982870" ; affx:stopsAt "167055232" ]; affx:hasExon [ affx:relatesToExon :Gene6_e1; affx:cdsType "Partial" ; affx:cdsStart "166982870" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene6_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene6_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene6_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene6_e11; affx:cdsType "Partial" ; affx:cdsStop "167055232" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "21" ; affx:spannedBy [ affx:startsAt "166982870" ; affx:stopsAt "166982928" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "167049328" ; affx:stopsAt "167049333" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "31" ; affx:stopsAt "53" ; affx:spannedBy [ affx:startsAt "167049363" ; affx:stopsAt "167049429" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene6_e1 a affx:Exon ; affx:startsAt "166982730" ; affx:stopsAt "166982928" ; affx:commonToAll "0" . :Gene6_e2 a affx:Exon ; affx:startsAt "166982764" ; affx:stopsAt "166982928" ; affx:commonToAll "0" . :Gene6_e3 a affx:Exon ; affx:startsAt "166982806" ; affx:stopsAt "166982928" ; affx:commonToAll "0" . :Gene6_e4 a affx:Exon ; affx:startsAt "167049328" ; affx:stopsAt "167049432" ; affx:commonToAll "1" . :Gene6_e5 a affx:Exon ; affx:startsAt "167050562" ; affx:stopsAt "167050619" ; affx:commonToAll "1" . :Gene6_e6 a affx:Exon ; affx:startsAt "167051578" ; affx:stopsAt "167051659" ; affx:commonToAll "1" . :Gene6_e7 a affx:Exon ; affx:startsAt "167052605" ; affx:stopsAt "167052641" ; affx:commonToAll "0" . :Gene6_e8 a affx:Exon ; affx:startsAt "167052608" ; affx:stopsAt "167052641" ; affx:commonToAll "0" . :Gene6_e9 a affx:Exon ; affx:startsAt "167053381" ; affx:stopsAt "167053438" ; affx:commonToAll "1" . :Gene6_e10 a affx:Exon ; affx:startsAt "167053951" ; affx:stopsAt "167053987" ; affx:commonToAll "1" . :Gene6_e11 a affx:Exon ; affx:startsAt "167055166" ; affx:stopsAt "167056275" ; affx:commonToAll "0" . :Gene6_e12 a affx:Exon ; affx:startsAt "167061742" ; affx:stopsAt "167061836" ; affx:commonToAll "0" . :Gene6_e13 a affx:Exon ; affx:startsAt "167061742" ; affx:stopsAt "167062522" ; affx:commonToAll "0" . :Gene6_e14 a affx:Exon ; affx:startsAt "167064166" ; affx:stopsAt "167065406" ; affx:commonToAll "0" . :Gene7 a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi10503936] ; affx:hasVariant [affx:representedBy :gi5305701] . :gi10503936 a affx:Transcript ; affx:unigene "iMm.29544" ; affx:translatesTo "MRAVRAETPARELFRDAAFPASDSSLFYNLSTPLAQFREDITWRRPQEICATPQLFPDNPWEGQVKQGLLGDCWFLCACAALQKSQHLLDQVFPPGQPGWSDQKYQGFFTCRIWQFGHWEEVTIDDRLPCLAGRLCFSRCQREDVFWLPLLEKAYAKVHGSYEHLWAGQVADALVDLTGSLAERWSLKDVTKASGQQDRPSGGEHRTCRQLLHLKDRCLISCSVLSPRAGARELGEFHAFIISDLQELRSQTGQGILLLRIHNPWGRRCWQGLWREGGEGWNQVEPAKESELLAQLQEGEFWVEEEEFLREFDEVTIGYPVTEAGHLQSLHTERVLCHTRTLPGAWVTGQSAGGCRNNSCFPCNPKFWLRLLEPSEVCVAVLQRPRRRLVGQTRALAGASPAPVNLPGKDYQAVGLHIWKVEKRKISLPRVLSAPPVAGTACHAYDREIHLRCELSPGYYLAVPSTFLKDVPGQFLLRVFSTGKISLSAVRLATKGASPGTALPAGEWETVQLQGCWRAGQTAGGSRNFASYPCNPCLPFSVPEGAGPRYIRITLQQHCRLSDSQLHPIGFHVFQVPADGENQDACSLLLQEPLLSCVPHRYAQEVSRLCLLSVGNYRIVPSTYLPDTEGTFTVTIATRIDRQSIHSQEMLGQLLQEVSFMAVMKA" ; affx:hasCds [affx:startsAt "93384632" ; affx:stopsAt "93397298" ]; affx:hasExon [ affx:relatesToExon :Gene7_e1; affx:cdsType "Partial" ; affx:cdsStart "93384632" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene7_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene7_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene7_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene7_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene7_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene7_e13; affx:cdsType "Partial" ; affx:cdsStop "93397298" ; affx:frame "2"] ; . :gi5305701 a affx:Transcript ; affx:unigene "iMm.29544" ; affx:translatesTo "MRAVRAETPARELFRDAAFPASDSSLFYNLSTPLAQFREDITWRRPQEICATPQLFPDNPWEGQVKQGLLGDCWFLCACAALQKSQHLLDQVFPPGQPGWSDQKYQGFFTCRIWQFGHWEEVTIDDRLPCLAGRLCFSRCQREDVFWLPLLEKAYAKVHGSYEHLWAGQVADALVDLTGSLAERWSLKDVTKASGQQDRPSGGEHRTCRQLLHLKDRCLISCSVLSPRAGARELGEFHAFIISDLQELRSQTGQGILLLRIHNPWGRRCWQGLWREGGEGWNQVEPAKESELLAQLQEGEFWVEEEEFLREFDEVTIGYPVTEAGHLQSLHTERVLCHTRTLPGAWVTGQSAGGCRNNSCFPCNPKFWLRLLEPSEVCVAVLQRPRRRLVGQTRALAGASPAPVNLPGKDYQAVGLHIWKVEKRKISLPRVLSAPPVAGTACHAYDREIHLRCELSPGYYLAVPSTFLKDVPGQFLLRVFSTGKISLSAVRLATKGASPGTALPAGEWETVQLQGCWRAGQTAGGSRNFASYPCNPCLPFSVPEGAGPRYIRITLQQHCRLSDSQLHPIGFHVFQVPADGENQDACSLLLQEPLLSCVPHRTPRK" ; affx:hasCds [affx:startsAt "93384632" ; affx:stopsAt "93396627" ]; affx:hasExon [ affx:relatesToExon :Gene7_e2; affx:cdsType "Partial" ; affx:cdsStart "93384632" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene7_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene7_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene7_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene7_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene7_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e11; affx:cdsType "Partial" ; affx:cdsStop "93396610" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene7_e12; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene7_e14; affx:cdsType "None" ] ; . :Gene7_e1 a affx:Exon ; affx:startsAt "93384134" ; affx:stopsAt "93384773" ; affx:commonToAll "0" . :Gene7_e2 a affx:Exon ; affx:startsAt "93384612" ; affx:stopsAt "93384773" ; affx:commonToAll "0" . :Gene7_e3 a affx:Exon ; affx:startsAt "93387704" ; affx:stopsAt "93387836" ; affx:commonToAll "1" . :Gene7_e4 a affx:Exon ; affx:startsAt "93389082" ; affx:stopsAt "93389279" ; affx:commonToAll "1" . :Gene7_e5 a affx:Exon ; affx:startsAt "93390042" ; affx:stopsAt "93390260" ; affx:commonToAll "1" . :Gene7_e6 a affx:Exon ; affx:startsAt "93392241" ; affx:stopsAt "93392383" ; affx:commonToAll "1" . :Gene7_e7 a affx:Exon ; affx:startsAt "93393059" ; affx:stopsAt "93393226" ; affx:commonToAll "1" . :Gene7_e8 a affx:Exon ; affx:startsAt "93393438" ; affx:stopsAt "93393701" ; affx:commonToAll "1" . :Gene7_e9 a affx:Exon ; affx:startsAt "93394454" ; affx:stopsAt "93394657" ; affx:commonToAll "1" . :Gene7_e10 a affx:Exon ; affx:startsAt "93394776" ; affx:stopsAt "93395038" ; affx:commonToAll "1" . :Gene7_e11 a affx:Exon ; affx:startsAt "93396533" ; affx:stopsAt "93396733" ; affx:commonToAll "1" . :Gene7_e12 a affx:Exon ; affx:startsAt "93396974" ; affx:stopsAt "93397020" ; affx:commonToAll "1" . :Gene7_e13 a affx:Exon ; affx:startsAt "93397268" ; affx:stopsAt "93397700" ; affx:commonToAll "0" . :Gene7_e14 a affx:Exon ; affx:startsAt "93397268" ; affx:stopsAt "93397701" ; affx:commonToAll "0" . :STY a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi201070] ; affx:hasVariant [affx:representedBy :gi6753445] ; affx:hasVariant [affx:representedBy :gi706957] . :gi201070 a affx:Transcript ; affx:unigene "iMm.1761" ; affx:translatesTo "MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESRSINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRHHTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFRCVQMLEWFEHRGHICIVFELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKRRYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEALKHPFFYPLKKHT" ; affx:hasCds [affx:startsAt "58999975" ; affx:stopsAt "59009713" ]; affx:hasExon [ affx:relatesToExon :STY_e1; affx:cdsType "Partial" ; affx:cdsStart "58999975" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :STY_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :STY_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :STY_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :STY_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :STY_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e17; affx:cdsType "None" ] ; . :gi6753445 a affx:Transcript ; affx:unigene "iMm.1761" ; affx:translatesTo "MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESRSINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRHHTSQHHSHGMKLLIL" ; affx:hasCds [affx:startsAt "59007491" ; affx:stopsAt "59009713" ]; affx:hasExon [ affx:relatesToExon :STY_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e7; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e8; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e9; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e10; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e11; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e13; affx:cdsType "Partial" ; affx:cdsStart "59007491" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :STY_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e17; affx:cdsType "None" ] ; . :gi706957 a affx:Transcript ; affx:unigene "iMm.1761" ; affx:translatesTo "MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESRSINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRHHTSQHHSHGMKLLIL" ; affx:hasCds [affx:startsAt "59007491" ; affx:stopsAt "59009713" ]; affx:hasExon [ affx:relatesToExon :STY_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e4; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e6; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e7; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e8; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e9; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e12; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :STY_e13; affx:cdsType "Partial" ; affx:cdsStart "59007491" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :STY_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :STY_e17; affx:cdsType "None" ] ; . :STY_e1 a affx:Exon ; affx:startsAt "58999778" ; affx:stopsAt "59000119" ; affx:commonToAll "0" . :STY_e2 a affx:Exon ; affx:startsAt "58999978" ; affx:stopsAt "59000119" ; affx:commonToAll "0" . :STY_e3 a affx:Exon ; affx:startsAt "59000425" ; affx:stopsAt "59000516" ; affx:commonToAll "0" . :STY_e4 a affx:Exon ; affx:startsAt "59000425" ; affx:stopsAt "59000517" ; affx:commonToAll "0" . :STY_e5 a affx:Exon ; affx:startsAt "59000725" ; affx:stopsAt "59000805" ; affx:commonToAll "0" . :STY_e6 a affx:Exon ; affx:startsAt "59000727" ; affx:stopsAt "59000805" ; affx:commonToAll "0" . :STY_e7 a affx:Exon ; affx:startsAt "59001168" ; affx:stopsAt "59001251" ; affx:commonToAll "1" . :STY_e8 a affx:Exon ; affx:startsAt "59002150" ; affx:stopsAt "59002280" ; affx:commonToAll "1" . :STY_e9 a affx:Exon ; affx:startsAt "59002368" ; affx:stopsAt "59002463" ; affx:commonToAll "1" . :STY_e10 a affx:Exon ; affx:startsAt "59004791" ; affx:stopsAt "59004958" ; affx:commonToAll "0" . :STY_e11 a affx:Exon ; affx:startsAt "59005045" ; affx:stopsAt "59005162" ; affx:commonToAll "0" . :STY_e12 a affx:Exon ; affx:startsAt "59005047" ; affx:stopsAt "59005162" ; affx:commonToAll "0" . :STY_e13 a affx:Exon ; affx:startsAt "59007445" ; affx:stopsAt "59007512" ; affx:commonToAll "1" . :STY_e14 a affx:Exon ; affx:startsAt "59007899" ; affx:stopsAt "59007990" ; affx:commonToAll "0" . :STY_e15 a affx:Exon ; affx:startsAt "59008861" ; affx:stopsAt "59009087" ; affx:commonToAll "1" . :STY_e16 a affx:Exon ; affx:startsAt "59009552" ; affx:stopsAt "59009713" ; affx:commonToAll "1" . :STY_e17 a affx:Exon ; affx:startsAt "59011704" ; affx:stopsAt "59011789" ; affx:commonToAll "1" . :Gene9 a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi15126657] ; affx:hasVariant [affx:representedBy :gi6671655] . :gi15126657 a affx:Transcript ; affx:unigene "iMm.14087" ; affx:translatesTo "MCAKQQQTLLPTRAAHGRLHRNRDAVAWPFSTLCRVSGPTLFQMTFTAALWVAVFGKCGPPPAIPNALPASDVNRTDFESHTTLKYECLPGYGRGISRMMVYCKPSGEWEISVSCAKKHCRNPGYLDNGYVNGETITFGSQIEFSCQEGFILVGSSTSSCEVRGKGVAWSNPFPECVIVKCGPPPDISNGKHSGTEDFYPYNHGISYTCDPGFRLVGSPFIGCTVVNKTVPVWSSSPPTCEKIICSQPNILHGVIVSGYKATYTHRDSVRLACLNGTVLRGRHVIECQGNGNWSSLPTCEFDCDLPPAIVNGYYTSMVYSKITLVTYECDKGYRLVGKAIISCSFSKWKGTAPQCKALCQKPEVGNGTLSDEKDQYVESENVTIQCDSGFAMLGSQSISCSESGTWYPEVPRCEQEASEDLKPALTGNKTMQYVPNSHDVKMALEIYKLTLEVELLQLQIQKEKHTEAH" ; affx:hasCds [affx:startsAt "131466462" ; affx:stopsAt "131487988" ]; affx:hasExon [ affx:relatesToExon :Gene9_e2; affx:cdsType "Partial" ; affx:cdsStart "131466462" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene9_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene9_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene9_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene9_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene9_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene9_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene9_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene9_e10; affx:cdsType "Partial" ; affx:cdsStop "131487988" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene9_e11; affx:cdsType "None" ] ; . :gi6671655 a affx:Transcript ; affx:unigene "iMm.14087" ; affx:translatesTo "MTFTAALWVAVFGKCGPPPAIPNALPASDVNRTDFESHTTLKYECLPGYGRGISRMMVYCKPSGEWEISVSCAKKHCRNPGYLDNGYVNGETITFGSQIEFSCQEGFILVGSSTSSCEVRGKGVAWSNPFPECVIVKCGPPPDISNGKHSGTEDFYPYNHGISYTCDPGFRLVGSPFIGCTVVNKTVPVWSSSPPTCEKIICSQPNILHGVIVSGYKATYTHRDSVRLACLNGTVLRGRHVIECQGNGNWSSLPTCEFDCDLPPAIVNGYYTSMVYSKITLVTYECDKGYRLVGKAIISCSFSKWKGTAPQCKALCQKPEVGNGTLSDEKDQYVESENVTIQCDSGFAMLGSQSISCSESGTWYPEVPRCEQEASEDLKPALTGNKTMQYVPNSHDVKMALEIYKLTLEVELLQLQIQKEKHTEAH" ; affx:hasCds [affx:startsAt "131466462" ; affx:stopsAt "131487859" ]; affx:hasExon [ affx:relatesToExon :Gene9_e1; affx:cdsType "Partial" ; affx:cdsStart "131466462" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene9_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene9_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene9_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene9_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene9_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene9_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene9_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene9_e10; affx:cdsType "Partial" ; affx:cdsStop "131487859" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene9_e12; affx:cdsType "None" ] ; . :Gene9_e1 a affx:Exon ; affx:startsAt "131466185" ; affx:stopsAt "131466627" ; affx:commonToAll "0" . :Gene9_e2 a affx:Exon ; affx:startsAt "131466267" ; affx:stopsAt "131466627" ; affx:commonToAll "0" . :Gene9_e3 a affx:Exon ; affx:startsAt "131466957" ; affx:stopsAt "131467133" ; affx:commonToAll "1" . :Gene9_e4 a affx:Exon ; affx:startsAt "131469426" ; affx:stopsAt "131469591" ; affx:commonToAll "1" . :Gene9_e5 a affx:Exon ; affx:startsAt "131473291" ; affx:stopsAt "131473471" ; affx:commonToAll "1" . :Gene9_e6 a affx:Exon ; affx:startsAt "131478386" ; affx:stopsAt "131478578" ; affx:commonToAll "1" . :Gene9_e7 a affx:Exon ; affx:startsAt "131478741" ; affx:stopsAt "131478827" ; affx:commonToAll "1" . :Gene9_e8 a affx:Exon ; affx:startsAt "131484015" ; affx:stopsAt "131484112" ; affx:commonToAll "1" . :Gene9_e9 a affx:Exon ; affx:startsAt "131486571" ; affx:stopsAt "131486754" ; affx:commonToAll "1" . :Gene9_e10 a affx:Exon ; affx:startsAt "131487822" ; affx:stopsAt "131488005" ; affx:commonToAll "1" . :Gene9_e11 a affx:Exon ; affx:startsAt "131492138" ; affx:stopsAt "131492280" ; affx:commonToAll "0" . :Gene9_e12 a affx:Exon ; affx:startsAt "131492138" ; affx:stopsAt "131492323" ; affx:commonToAll "0" . :Gene10 a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi3341864] ; affx:hasVariant [affx:representedBy :gi3978552] ; affx:hasVariant [affx:representedBy :gi6177732] . :gi3341864 a affx:Transcript ; affx:unigene "iMm.12884" ; affx:translatesTo "MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAWIIALIVITSIVGVFILCLIVLRCFEHRKKTNVSAAR" ; affx:hasCds [affx:startsAt "196576347" ; affx:stopsAt "196624100" ]; affx:hasExon [ affx:relatesToExon :Gene10_e1; affx:cdsType "Partial" ; affx:cdsStart "196576347" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene10_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene10_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene10_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene10_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene10_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene10_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "20" ; affx:stopsAt "42" ; affx:spannedBy [ affx:startsAt "196623974" ; affx:stopsAt "196624040" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "328" ; affx:stopsAt "350" ; affx:spannedBy [ affx:startsAt "196596564" ; affx:stopsAt "196596595" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "196594255" ; affx:stopsAt "196594290" ; affx:inFrame "1" ] ; ] ; ] ; . :gi3978552 a affx:Transcript ; affx:unigene "iMm.12884" ; affx:translatesTo "MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAWIIALIVITSIVGVFILCLIVLRCFEHRKKTNVSAAR" ; affx:hasCds [affx:startsAt "196576347" ; affx:stopsAt "196624100" ]; affx:hasExon [ affx:relatesToExon :Gene10_e2; affx:cdsType "Partial" ; affx:cdsStart "196576347" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene10_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene10_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene10_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene10_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene10_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene10_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e16; affx:cdsType "Partial" ; affx:cdsStop "196624100" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "20" ; affx:stopsAt "42" ; affx:spannedBy [ affx:startsAt "196623974" ; affx:stopsAt "196624040" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "328" ; affx:stopsAt "350" ; affx:spannedBy [ affx:startsAt "196596564" ; affx:stopsAt "196596595" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "196594255" ; affx:stopsAt "196594290" ; affx:inFrame "1" ] ; ] ; ] ; . :gi6177732 a affx:Transcript ; affx:unigene "iMm.12884" ; affx:translatesTo "MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKVTFY" ; affx:hasCds [affx:startsAt "196608467" ; affx:stopsAt "196624100" ]; affx:hasExon [ affx:relatesToExon :Gene10_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene10_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene10_e4; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene10_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene10_e7; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene10_e9; affx:cdsType "Partial" ; affx:cdsStart "196608467" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene10_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene10_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene10_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "20" ; affx:stopsAt "42" ; affx:spannedBy [ affx:startsAt "196623974" ; affx:stopsAt "196624040" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene10_e1 a affx:Exon ; affx:startsAt "196576255" ; affx:stopsAt "196576369" ; affx:commonToAll "0" . :Gene10_e2 a affx:Exon ; affx:startsAt "196576309" ; affx:stopsAt "196576369" ; affx:commonToAll "0" . :Gene10_e3 a affx:Exon ; affx:startsAt "196594229" ; affx:stopsAt "196594290" ; affx:commonToAll "1" . :Gene10_e4 a affx:Exon ; affx:startsAt "196596564" ; affx:stopsAt "196596600" ; affx:commonToAll "1" . :Gene10_e5 a affx:Exon ; affx:startsAt "196600003" ; affx:stopsAt "196600042" ; affx:commonToAll "0" . :Gene10_e6 a affx:Exon ; affx:startsAt "196600003" ; affx:stopsAt "196600045" ; affx:commonToAll "0" . :Gene10_e7 a affx:Exon ; affx:startsAt "196607384" ; affx:stopsAt "196607435" ; affx:commonToAll "0" . :Gene10_e8 a affx:Exon ; affx:startsAt "196607387" ; affx:stopsAt "196607435" ; affx:commonToAll "0" . :Gene10_e9 a affx:Exon ; affx:startsAt "196608408" ; affx:stopsAt "196608481" ; affx:commonToAll "0" . :Gene10_e10 a affx:Exon ; affx:startsAt "196609531" ; affx:stopsAt "196609714" ; affx:commonToAll "1" . :Gene10_e11 a affx:Exon ; affx:startsAt "196614459" ; affx:stopsAt "196614657" ; affx:commonToAll "1" . :Gene10_e12 a affx:Exon ; affx:startsAt "196615425" ; affx:stopsAt "196615514" ; affx:commonToAll "1" . :Gene10_e13 a affx:Exon ; affx:startsAt "196617210" ; affx:stopsAt "196617313" ; affx:commonToAll "1" . :Gene10_e14 a affx:Exon ; affx:startsAt "196617969" ; affx:stopsAt "196618158" ; affx:commonToAll "1" . :Gene10_e15 a affx:Exon ; affx:startsAt "196623973" ; affx:stopsAt "196624100" ; affx:commonToAll "0" . :Gene10_e16 a affx:Exon ; affx:startsAt "196623973" ; affx:stopsAt "196624120" ; affx:commonToAll "0" . :5730518J08Rik a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi13385145] ; affx:hasVariant [affx:representedBy :gi13905310] ; affx:hasVariant [affx:representedBy :gi17512310] . :gi13385145 a affx:Transcript ; affx:unigene "iMm.43671" ; affx:translatesTo "MIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR" ; affx:hasCds [affx:startsAt "67348807" ; affx:stopsAt "67348918" ]; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e4; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e6; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e7; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e10; affx:cdsType "Partial" ; affx:cdsStart "67348807" ; affx:cdsStop "67348918" ; affx:frame "0"] ; . :gi13905310 a affx:Transcript ; affx:unigene "iMm.43671" ; affx:translatesTo "MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRP" ; affx:hasCds [affx:startsAt "67332024" ; affx:stopsAt "67345647" ]; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e3; affx:cdsType "Partial" ; affx:cdsStart "67332024" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e5; affx:cdsType "Partial" ; affx:cdsStop "67345647" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e6; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e7; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e9; affx:cdsType "None" ] ; . :gi17512310 a affx:Transcript ; affx:unigene "iMm.43671" ; affx:translatesTo "MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR" ; affx:hasCds [affx:startsAt "67332024" ; affx:stopsAt "67348918" ]; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e1; affx:cdsType "Partial" ; affx:cdsStart "67332024" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :5730518J08Rik_e8; affx:cdsType "Partial" ; affx:cdsStop "67348918" ; affx:frame "2"] ; . :5730518J08Rik_e1 a affx:Exon ; affx:startsAt "67331977" ; affx:stopsAt "67332146" ; affx:commonToAll "0" . :5730518J08Rik_e2 a affx:Exon ; affx:startsAt "67332010" ; affx:stopsAt "67332146" ; affx:commonToAll "0" . :5730518J08Rik_e3 a affx:Exon ; affx:startsAt "67332016" ; affx:stopsAt "67332146" ; affx:commonToAll "0" . :5730518J08Rik_e4 a affx:Exon ; affx:startsAt "67337563" ; affx:stopsAt "67337643" ; affx:commonToAll "1" . :5730518J08Rik_e5 a affx:Exon ; affx:startsAt "67345618" ; affx:stopsAt "67345758" ; affx:commonToAll "1" . :5730518J08Rik_e6 a affx:Exon ; affx:startsAt "67346154" ; affx:stopsAt "67346289" ; affx:commonToAll "1" . :5730518J08Rik_e7 a affx:Exon ; affx:startsAt "67347000" ; affx:stopsAt "67347087" ; affx:commonToAll "1" . :5730518J08Rik_e8 a affx:Exon ; affx:startsAt "67348795" ; affx:stopsAt "67349461" ; affx:commonToAll "0" . :5730518J08Rik_e9 a affx:Exon ; affx:startsAt "67348795" ; affx:stopsAt "67350558" ; affx:commonToAll "0" . :5730518J08Rik_e10 a affx:Exon ; affx:startsAt "67348795" ; affx:stopsAt "67350847" ; affx:commonToAll "0" . :1300007B12Rik a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi10181211] ; affx:hasVariant [affx:representedBy :gi13096831] . :gi10181211 a affx:Transcript ; affx:unigene "iMm.18230" ; affx:translatesTo "MARGSGQLGGPHRDTVTMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAIQQEVKSLCGLEASQVPAEEALSGVGEPCDILDSSDEMDAQEESTQERSVSRKKKSKRHKEDPDGTGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPLRLRPESMEKLRCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCMERLQPPIQYQDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVRGGQNLRSEQGVQVVLDPVHSVRLFDWWHPQYPFSLRA" ; affx:hasCds [affx:startsAt "135216608" ; affx:stopsAt "135230473" ]; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e1; affx:cdsType "Partial" ; affx:cdsStart "135216608" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e11; affx:cdsType "Partial" ; affx:cdsStop "135230473" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "297" ; affx:stopsAt "319" ; affx:spannedBy [ affx:startsAt "135218682" ; affx:stopsAt "135218733" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "135216779" ; affx:stopsAt "135216794" ; affx:inFrame "1" ] ; ] ; ] ; . :gi13096831 a affx:Transcript ; affx:unigene "iMm.18230" ; affx:translatesTo "MARGSGQLGGPHRDTVTMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAIQQEVKSLCGLEASQVPAEEALSGVGEPCDILDSSDEMDAQEESTQERSVSRKKKSKRHKDPDGTGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPLRLRPESMEKLRCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCMERLQPPIQYQDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVRGGQNLRSEQGVQVVLDPVHSVRLFDWWHPQYPFSLRA" ; affx:hasCds [affx:startsAt "135216608" ; affx:stopsAt "135230473" ]; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e2; affx:cdsType "Partial" ; affx:cdsStart "135216608" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :1300007B12Rik_e10; affx:cdsType "Partial" ; affx:cdsStop "135230473" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "296" ; affx:stopsAt "318" ; affx:spannedBy [ affx:startsAt "135218682" ; affx:stopsAt "135218733" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "135216779" ; affx:stopsAt "135216794" ; affx:inFrame "1" ] ; ] ; ] ; . :1300007B12Rik_e1 a affx:Exon ; affx:startsAt "135214696" ; affx:stopsAt "135216794" ; affx:commonToAll "0" . :1300007B12Rik_e2 a affx:Exon ; affx:startsAt "135214697" ; affx:stopsAt "135216794" ; affx:commonToAll "0" . :1300007B12Rik_e3 a affx:Exon ; affx:startsAt "135218682" ; affx:stopsAt "135218838" ; affx:commonToAll "1" . :1300007B12Rik_e4 a affx:Exon ; affx:startsAt "135220954" ; affx:stopsAt "135221035" ; affx:commonToAll "1" . :1300007B12Rik_e5 a affx:Exon ; affx:startsAt "135223260" ; affx:stopsAt "135223441" ; affx:commonToAll "1" . :1300007B12Rik_e6 a affx:Exon ; affx:startsAt "135224159" ; affx:stopsAt "135224313" ; affx:commonToAll "0" . :1300007B12Rik_e7 a affx:Exon ; affx:startsAt "135224159" ; affx:stopsAt "135224316" ; affx:commonToAll "0" . :1300007B12Rik_e8 a affx:Exon ; affx:startsAt "135229359" ; affx:stopsAt "135229527" ; affx:commonToAll "1" . :1300007B12Rik_e9 a affx:Exon ; affx:startsAt "135230136" ; affx:stopsAt "135230226" ; affx:commonToAll "1" . :1300007B12Rik_e10 a affx:Exon ; affx:startsAt "135230364" ; affx:stopsAt "135230530" ; affx:commonToAll "0" . :1300007B12Rik_e11 a affx:Exon ; affx:startsAt "135230364" ; affx:stopsAt "135230558" ; affx:commonToAll "0" . :2810430M08Rik a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi13385539] ; affx:hasVariant [affx:representedBy :gi13905009] . :gi13385539 a affx:Transcript ; affx:unigene "iMm.38528" ; affx:translatesTo "MKMVAKAAASKLEDEVKDSSDGEGSCDSEMDHSDDGAAEADSEDNVESCEEDNEDAAESSAGTNSGWADAMAKILNKKTPKSKATILTKNKELEKEKEKLKQERLEKRKQLDKKREWEMLCRVKPDVVKDKEAERNLQRIATRGVVQLFNAVQKHQRNVGEKVKEAGGSVRKRAKLMSTVSKKDFISVLRGMDGTSRNSPAGKSPKARQTEVKSEESPGWKILRDDFMMGASMKDWDKESEGEEPAGGRAEAAASR" ; affx:hasCds [affx:startsAt "187850624" ; affx:stopsAt "187881004" ]; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e1; affx:cdsType "Partial" ; affx:cdsStart "187850624" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e6; affx:cdsType "Partial" ; affx:cdsStop "187881004" ; affx:frame "0"] ; . :gi13905009 a affx:Transcript ; affx:unigene "iMm.38528" ; affx:translatesTo "MAAAVQDSRVSPGEILKRSPKKKKKMKMVAKAAASKLEDEVKDSSDGEGSCDSEMDHSDDGAAEADSEDNVESCEEDNEDAAESSAGTNSGWADAMAKILNKKTPKSKATILTKNKELEKEKEKLKQERLEKRKQLDKKREWEMLCRVKPDVVKDKEAERNLQRIATRGVVQLFNAVQKHQRNVGEKVKEAGGSVRKRAKLMSTVSKKDFISVLRGMDGTSRNSPAGKSPKARQTEVKSEESPGWKILRDDFMMGASMKDWDKESEGEEPAGGRAEAAASR" ; affx:hasCds [affx:startsAt "187850624" ; affx:stopsAt "187881079" ]; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e2; affx:cdsType "Partial" ; affx:cdsStart "187850624" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :2810430M08Rik_e7; affx:cdsType "Partial" ; affx:cdsStop "187881079" ; affx:frame "0"] ; . :2810430M08Rik_e1 a affx:Exon ; affx:startsAt "187850313" ; affx:stopsAt "187850768" ; affx:commonToAll "0" . :2810430M08Rik_e2 a affx:Exon ; affx:startsAt "187850471" ; affx:stopsAt "187850768" ; affx:commonToAll "0" . :2810430M08Rik_e3 a affx:Exon ; affx:startsAt "187867886" ; affx:stopsAt "187868085" ; affx:commonToAll "1" . :2810430M08Rik_e4 a affx:Exon ; affx:startsAt "187869358" ; affx:stopsAt "187869456" ; affx:commonToAll "1" . :2810430M08Rik_e5 a affx:Exon ; affx:startsAt "187871374" ; affx:stopsAt "187871634" ; affx:commonToAll "1" . :2810430M08Rik_e6 a affx:Exon ; affx:startsAt "187880934" ; affx:stopsAt "187881071" ; affx:commonToAll "0" . :2810430M08Rik_e7 a affx:Exon ; affx:startsAt "187880934" ; affx:stopsAt "187881095" ; affx:commonToAll "0" . :1110002A21Rik a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi13385627] ; affx:hasVariant [affx:representedBy :gi18043402] . :gi13385627 a affx:Transcript ; affx:unigene "iMm.27404" ; affx:translatesTo "MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLMWFVSNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLMVLYGLSLALGWNFTHTLCSFYKYRVK" ; affx:hasCds [affx:startsAt "37936755" ; affx:stopsAt "37944277" ]; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e3; affx:cdsType "Partial" ; affx:cdsStart "37936755" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e7; affx:cdsType "Partial" ; affx:cdsStop "37944277" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "83" ; affx:stopsAt "102" ; affx:spannedBy [ affx:startsAt "37937004" ; affx:stopsAt "37937035" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "37938009" ; affx:stopsAt "37938035" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "114" ; affx:stopsAt "136" ; affx:spannedBy [ affx:startsAt "37938071" ; affx:stopsAt "37938130" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "37942620" ; affx:stopsAt "37942627" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "162" ; affx:stopsAt "184" ; affx:spannedBy [ affx:startsAt "37942705" ; affx:stopsAt "37942760" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "37942835" ; affx:stopsAt "37942846" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "191" ; affx:stopsAt "213" ; affx:spannedBy [ affx:startsAt "37942867" ; affx:stopsAt "37942933" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "223" ; affx:stopsAt "245" ; affx:spannedBy [ affx:startsAt "37944166" ; affx:stopsAt "37944232" ; affx:inFrame "0" ] ; ] ; ] ; . :gi18043402 a affx:Transcript ; affx:unigene "iMm.27404" ; affx:translatesTo "MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLMWFVSNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLMVLYGLSLALGWNFTHTLCSFYKYRVK" ; affx:hasCds [affx:startsAt "37936755" ; affx:stopsAt "37944277" ]; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e3; affx:cdsType "Partial" ; affx:cdsStart "37936755" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :1110002A21Rik_e8; affx:cdsType "Partial" ; affx:cdsStop "37944277" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "83" ; affx:stopsAt "102" ; affx:spannedBy [ affx:startsAt "37937004" ; affx:stopsAt "37937035" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "37938009" ; affx:stopsAt "37938035" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "114" ; affx:stopsAt "136" ; affx:spannedBy [ affx:startsAt "37938071" ; affx:stopsAt "37938130" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "37942620" ; affx:stopsAt "37942627" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "162" ; affx:stopsAt "184" ; affx:spannedBy [ affx:startsAt "37942705" ; affx:stopsAt "37942760" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "37942835" ; affx:stopsAt "37942846" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "191" ; affx:stopsAt "213" ; affx:spannedBy [ affx:startsAt "37942867" ; affx:stopsAt "37942933" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "223" ; affx:stopsAt "245" ; affx:spannedBy [ affx:startsAt "37944166" ; affx:stopsAt "37944232" ; affx:inFrame "0" ] ; ] ; ] ; . :1110002A21Rik_e1 a affx:Exon ; affx:startsAt "37935644" ; affx:stopsAt "37935741" ; affx:commonToAll "0" . :1110002A21Rik_e2 a affx:Exon ; affx:startsAt "37935663" ; affx:stopsAt "37935952" ; affx:commonToAll "0" . :1110002A21Rik_e3 a affx:Exon ; affx:startsAt "37936751" ; affx:stopsAt "37937035" ; affx:commonToAll "1" . :1110002A21Rik_e4 a affx:Exon ; affx:startsAt "37938009" ; affx:stopsAt "37938130" ; affx:commonToAll "1" . :1110002A21Rik_e5 a affx:Exon ; affx:startsAt "37942620" ; affx:stopsAt "37942760" ; affx:commonToAll "1" . :1110002A21Rik_e6 a affx:Exon ; affx:startsAt "37942835" ; affx:stopsAt "37942937" ; affx:commonToAll "1" . :1110002A21Rik_e7 a affx:Exon ; affx:startsAt "37944140" ; affx:stopsAt "37944443" ; affx:commonToAll "0" . :1110002A21Rik_e8 a affx:Exon ; affx:startsAt "37944140" ; affx:stopsAt "37944446" ; affx:commonToAll "0" . :Gbx-2 a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi662846] ; affx:hasVariant [affx:representedBy :gi6753951] . :gi662846 a affx:Transcript ; affx:unigene "iMm.1306" ; affx:translatesTo "MMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPPPPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKAFLAKEGSLLAFSAAEAVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP" ; affx:hasCds [affx:startsAt "90352529" ; affx:stopsAt "90354638" ]; affx:hasExon [ affx:relatesToExon :Gbx-2_e2; affx:cdsType "Partial" ; affx:cdsStart "90352529" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gbx-2_e3; affx:cdsType "Partial" ; affx:cdsStop "90354638" ; affx:frame "0"] ; . :gi6753951 a affx:Transcript ; affx:unigene "iMm.1306" ; affx:translatesTo "MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPPPPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKAFLAKEGSLLAFSAAEAVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEPSRNPKIVVPIPVHVSRFAIRSQHQQLEQARP" ; affx:hasCds [affx:startsAt "90352529" ; affx:stopsAt "90354665" ]; affx:hasExon [ affx:relatesToExon :Gbx-2_e1; affx:cdsType "Partial" ; affx:cdsStart "90352529" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gbx-2_e4; affx:cdsType "Partial" ; affx:cdsStop "90354665" ; affx:frame "0"] ; . :Gbx-2_e1 a affx:Exon ; affx:startsAt "90351809" ; affx:stopsAt "90353053" ; affx:commonToAll "0" . :Gbx-2_e2 a affx:Exon ; affx:startsAt "90351871" ; affx:stopsAt "90353053" ; affx:commonToAll "0" . :Gbx-2_e3 a affx:Exon ; affx:startsAt "90354142" ; affx:stopsAt "90355058" ; affx:commonToAll "0" . :Gbx-2_e4 a affx:Exon ; affx:startsAt "90354142" ; affx:stopsAt "90355087" ; affx:commonToAll "0" . :Gene16 a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi3551818] ; affx:hasVariant [affx:representedBy :gi3907617] . :gi3551818 a affx:Transcript ; affx:unigene "iMm.116739" ; affx:translatesTo "MACGGKRLLFLALAWVLLAHLCSQAEAASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM" ; affx:hasCds [affx:startsAt "84002967" ; affx:stopsAt "84004861" ]; affx:hasExon [ affx:relatesToExon :Gene16_e1; affx:cdsType "Partial" ; affx:cdsStart "84002967" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene16_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene16_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene16_e7; affx:cdsType "Partial" ; affx:cdsStop "84004861" ; affx:frame "1"] ; . :gi3907617 a affx:Transcript ; affx:unigene "iMm.116739" ; affx:translatesTo "MACGGKRLLFLALAWVLLAHLCSQAEASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM" ; affx:hasCds [affx:startsAt "84002967" ; affx:stopsAt "84004861" ]; affx:hasExon [ affx:relatesToExon :Gene16_e2; affx:cdsType "Partial" ; affx:cdsStart "84002967" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene16_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene16_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene16_e6; affx:cdsType "Partial" ; affx:cdsStop "84004861" ; affx:frame "1"] ; . :Gene16_e1 a affx:Exon ; affx:startsAt "84002933" ; affx:stopsAt "84003046" ; affx:commonToAll "0" . :Gene16_e2 a affx:Exon ; affx:startsAt "84002936" ; affx:stopsAt "84003046" ; affx:commonToAll "0" . :Gene16_e3 a affx:Exon ; affx:startsAt "84003939" ; affx:stopsAt "84004054" ; affx:commonToAll "0" . :Gene16_e4 a affx:Exon ; affx:startsAt "84003942" ; affx:stopsAt "84004054" ; affx:commonToAll "0" . :Gene16_e5 a affx:Exon ; affx:startsAt "84004142" ; affx:stopsAt "84004220" ; affx:commonToAll "1" . :Gene16_e6 a affx:Exon ; affx:startsAt "84004839" ; affx:stopsAt "84004899" ; affx:commonToAll "0" . :Gene16_e7 a affx:Exon ; affx:startsAt "84004839" ; affx:stopsAt "84004955" ; affx:commonToAll "0" . :PS-2short a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi2315275] ; affx:hasVariant [affx:representedBy :gi2724097] ; affx:hasVariant [affx:representedBy :gi6755187] . :gi2315275 a affx:Transcript ; affx:unigene "iMm.4338" ; affx:translatesTo "MVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEAFEAPLPGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGNGDWNTTLACFIAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLVRPFMDTLASHQLYI" ; affx:hasCds [affx:startsAt "181610627" ; affx:stopsAt "181612975" ]; affx:hasExon [ affx:relatesToExon :PS-2short_e1; affx:cdsType "Partial" ; affx:cdsStart "181610627" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e7; affx:cdsType "Partial" ; affx:cdsStop "181612975" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "116" ; affx:stopsAt "133" ; affx:spannedBy [ affx:startsAt "181610684" ; affx:stopsAt "181610735" ; affx:inFrame "2" ] ; ] ; ] ; . :gi2724097 a affx:Transcript ; affx:unigene "iMm.4338" ; affx:translatesTo "MLAFMASDSEEEVCDERTSLMSAESPTSRSCQEGRPGPEDGESTAQWRTQESEEDCEEDPDRYACSGAPGRPSGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLFLAVWNFGAVGMVCIHWKGPLVLQQAYLIVISALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEDSYDSFGEPSYPEAFEAPLPGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGNGDWNTTLACFIAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLVRPFMDTLASHQLYI" ; affx:hasCds [affx:startsAt "181610627" ; affx:stopsAt "181627784" ]; affx:hasExon [ affx:relatesToExon :PS-2short_e2; affx:cdsType "Partial" ; affx:cdsStart "181610627" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e14; affx:cdsType "Partial" ; affx:cdsStop "181627784" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "6" ; affx:containsMotif [ affx:startsAt "88" ; affx:stopsAt "106" ; affx:spannedBy [ affx:startsAt "181623823" ; affx:stopsAt "181623877" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "138" ; affx:stopsAt "160" ; affx:spannedBy [ affx:startsAt "181621945" ; affx:stopsAt "181622011" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "167" ; affx:stopsAt "189" ; affx:spannedBy [ affx:startsAt "181618965" ; affx:stopsAt "181619030" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "181618263" ; affx:stopsAt "181618264" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "230" ; affx:stopsAt "247" ; affx:spannedBy [ affx:startsAt "181618089" ; affx:stopsAt "181618140" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "252" ; affx:stopsAt "274" ; affx:spannedBy [ affx:startsAt "181618043" ; affx:stopsAt "181618074" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "181616729" ; affx:stopsAt "181616764" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "412" ; affx:stopsAt "429" ; affx:spannedBy [ affx:startsAt "181610684" ; affx:stopsAt "181610735" ; affx:inFrame "2" ] ; ] ; ] ; . :gi6755187 a affx:Transcript ; affx:unigene "iMm.4338" ; affx:translatesTo "MLAFMASDSEEEVCDERTSLMSAESPTSRSCQEGRPGPEDGESTAQWRTQESEEDCEEDPDRYACSGAPGRPSGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLFLAVWNFGAVGMVCIHWKGPLVLQQAYLIVISALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEAFEAPLPGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGNGDWNTTLACFIAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLVRPFMDTLASHQLYI" ; affx:hasCds [affx:startsAt "181610627" ; affx:stopsAt "181627784" ]; affx:hasExon [ affx:relatesToExon :PS-2short_e1; affx:cdsType "Partial" ; affx:cdsStart "181610627" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e13; affx:cdsType "Partial" ; affx:cdsStop "181627784" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :PS-2short_e15; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "6" ; affx:containsMotif [ affx:startsAt "88" ; affx:stopsAt "106" ; affx:spannedBy [ affx:startsAt "181623823" ; affx:stopsAt "181623877" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "138" ; affx:stopsAt "160" ; affx:spannedBy [ affx:startsAt "181621945" ; affx:stopsAt "181622011" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "167" ; affx:stopsAt "189" ; affx:spannedBy [ affx:startsAt "181618965" ; affx:stopsAt "181619030" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "181618263" ; affx:stopsAt "181618264" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "230" ; affx:stopsAt "247" ; affx:spannedBy [ affx:startsAt "181618089" ; affx:stopsAt "181618140" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "252" ; affx:stopsAt "274" ; affx:spannedBy [ affx:startsAt "181618043" ; affx:stopsAt "181618074" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "181616729" ; affx:stopsAt "181616764" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "413" ; affx:stopsAt "430" ; affx:spannedBy [ affx:startsAt "181610684" ; affx:stopsAt "181610735" ; affx:inFrame "2" ] ; ] ; ] ; . :PS-2short_e1 a affx:Exon ; affx:startsAt "181610060" ; affx:stopsAt "181610783" ; affx:commonToAll "0" . :PS-2short_e2 a affx:Exon ; affx:startsAt "181610499" ; affx:stopsAt "181610783" ; affx:commonToAll "0" . :PS-2short_e3 a affx:Exon ; affx:startsAt "181611897" ; affx:stopsAt "181612016" ; affx:commonToAll "1" . :PS-2short_e4 a affx:Exon ; affx:startsAt "181612440" ; affx:stopsAt "181612539" ; affx:commonToAll "0" . :PS-2short_e5 a affx:Exon ; affx:startsAt "181612440" ; affx:stopsAt "181612542" ; affx:commonToAll "0" . :PS-2short_e6 a affx:Exon ; affx:startsAt "181612896" ; affx:stopsAt "181612980" ; affx:commonToAll "0" . :PS-2short_e7 a affx:Exon ; affx:startsAt "181612896" ; affx:stopsAt "181613099" ; affx:commonToAll "0" . :PS-2short_e8 a affx:Exon ; affx:startsAt "181616665" ; affx:stopsAt "181616764" ; affx:commonToAll "0" . :PS-2short_e9 a affx:Exon ; affx:startsAt "181618043" ; affx:stopsAt "181618264" ; affx:commonToAll "0" . :PS-2short_e10 a affx:Exon ; affx:startsAt "181618965" ; affx:stopsAt "181619033" ; affx:commonToAll "0" . :PS-2short_e11 a affx:Exon ; affx:startsAt "181621927" ; affx:stopsAt "181622069" ; affx:commonToAll "0" . :PS-2short_e12 a affx:Exon ; affx:startsAt "181623785" ; affx:stopsAt "181624000" ; affx:commonToAll "0" . :PS-2short_e13 a affx:Exon ; affx:startsAt "181627643" ; affx:stopsAt "181627787" ; affx:commonToAll "0" . :PS-2short_e14 a affx:Exon ; affx:startsAt "181627643" ; affx:stopsAt "181627790" ; affx:commonToAll "0" . :PS-2short_e15 a affx:Exon ; affx:startsAt "181627893" ; affx:stopsAt "181627931" ; affx:commonToAll "0" . :Gene18 a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi507330] ; affx:hasVariant [affx:representedBy :gi6746395] ; affx:hasVariant [affx:representedBy :gi6746397] ; affx:hasVariant [affx:representedBy :gi6746399] ; affx:hasVariant [affx:representedBy :gi6746401] . :gi507330 a affx:Transcript ; affx:unigene "iMm.4498" ; affx:translatesTo "MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETHYFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSRLQQEATRYQYYLQVKKDVLEGRLRCSLEQVIRLAGLAVQADFGDYNQFDSQEFLREYVLFPMDLAMEEAALEELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDSHGNSVHLGIFFMGIFVRNRVGRQAVIYRWNDIGSVTHSKAAILLELIDKEETALFHTDDIENAKYISRLFTTRHKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCSEHYSETHTSQDSIFPGNEEALYCRSHNSLDLNYLNGTVTNGSVCSVHSVNSLSCSQSFIQASPVSSNLSIPGSDIMRADYIPSHRHSTIIVPSYRPTPDYETVMRQMKRGLMHADSQSRSLRNLNIINTHAYNQPEELVYSQPEMRERHPYTVPYAHQGCYGHKLVSPSDQMNPQNCAMPIKPGASSISHTVSTPELANMQLQGAQHYSTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGGGGGTVNKRHSLEVMNSMVRGMEAMTLKSLNIPMARRNTLREQGPSEETGGHEVHGLPQYHHKKTFSDATMLIHSSESEEEEETLEAAPQVPVLREKVEYSAQLQAALARIPNRPPPEYPGPRKSVSNGALRQDQGTPLPAMARCRVLRHGPSKALSVSRAEQLAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSIIEREMMIRNLEKQKMTGPQAQKRPLMLAALNGLSVARVSGREDGHHDATRVPIDERLRALKKKLEDGMVFTEYEQIPNKKANGVFSTATLPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVGGSEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPHHGCPEDVQGFLSYLEEIQSVRRHTNSVLEGIRTRHPPIVVHCSAGVGRTGVVILSELMIYCLEHNEKVEVPTMLRFLREQRMFMIQTIAQYKFVYQVLVQFLQNSRLI" ; affx:hasCds [affx:startsAt "191136542" ; affx:stopsAt "191220061" ]; affx:hasExon [ affx:relatesToExon :Gene18_e1; affx:cdsType "Partial" ; affx:cdsStart "191136542" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e20; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e21; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e22; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e26; affx:cdsType "Partial" ; affx:cdsStop "191220061" ; affx:frame "2"] ; . :gi6746395 a affx:Transcript ; affx:unigene "iMm.4498" ; affx:translatesTo "MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETHYFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSRLQQEATRYQYYLQVKKDVLEGRLRCSLEQVIRLAGLAVQADFGDYNQFDSQEFLREYVLFPMDLAMEEAALEELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDSHGNSVHLGIFFMGIFVRNRVGRQAVIYRWNDIGSVTHSKAAILLELIDKEETALFHTDDIENAKYISRLFTTRHKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCSEHYSETHTSQDSIFPGNEEALYCRSHNSLDLNYLNGTVTNGSVCSVHSVNSLSCSQSFIQASPVSSNLSIPGSDIMRADYIPSHRHSTIIVPSYRPTPDYETVMRQMKRGLMHADSQSRSLRNLNIINTHAYNQPEELVYSQPEMRERHPYTVPYAHQGCYGHKLVSPSDQMNPQNCAMPIKPGASSISHTVSTPELANMQLQGAQHYSTAHMLKNYLFRPPPPYPRPECRGGKTVTMMPPESP" ; affx:hasCds [affx:startsAt "191136542" ; affx:stopsAt "191205121" ]; affx:hasExon [ affx:relatesToExon :Gene18_e3; affx:cdsType "Partial" ; affx:cdsStart "191136542" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e18; affx:cdsType "Partial" ; affx:cdsStop "191205121" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e19; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene18_e20; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene18_e21; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene18_e22; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene18_e24; affx:cdsType "None" ] ; . :gi6746397 a affx:Transcript ; affx:unigene "iMm.4498" ; affx:translatesTo "MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETHYFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSRLQQEATRYQYYLQVKKDVLEGRLRCSLEQVIRLAGLAVQADFGDYNQFDSQEFLREYVLFPMDLAMEEAALEELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDSHGNSVHLGIFFMGIFVRNRVGRQAVIYRWNDIGSVTHSKAAILLELIDKEETALFHTDDIENAKYISRLFTTRHKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCSEHYSETHTSQDSIFPGNEEALYCRSHNSLDLNYLNGTVTNGSVCSVHSVNSLSCSQSFIQASPVSSNLSIPGSDIMRADYIPSHRHSTIIVPSYRPTPDYETVMRQMKRGLMHADSQSRSLRNLNIINTHAYNQPEELVYSQPEMRERHPYTVPYAHQGCYGHKLNLEKQKMTGPQAQKRPLMLAALNGLSVARVSGREDGHHDATRVPIDERLRALKKKLEDGMVFTEYEQIPNKKANGVFSTATLPENAERSRIREVVPYEENRVELIPTKENNTGYINASHIKVVVGGSEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPHHGCPEDVQGFLSYLEEIQSVRRHTNSVLEGIRTRHPPIVVHCSAGVGRTGVVILSELMIYCLEHNEKVEVPTMLRFLREQRMFMIQTIAQYKFVYQVLVQFLQNSRLI" ; affx:hasCds [affx:startsAt "191136542" ; affx:stopsAt "191220061" ]; affx:hasExon [ affx:relatesToExon :Gene18_e3; affx:cdsType "Partial" ; affx:cdsStart "191136542" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e20; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e21; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e22; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e24; affx:cdsType "Partial" ; affx:cdsStop "191220061" ; affx:frame "2"] ; . :gi6746399 a affx:Transcript ; affx:unigene "iMm.4498" ; affx:translatesTo "MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETHYFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSRLQQEATSLLGGNPVSPTPHQQRAGRHQDQAPPHRGSLQRGCGKDWCGYPL" ; affx:hasCds [affx:startsAt "191136542" ; affx:stopsAt "191215697" ]; affx:hasExon [ affx:relatesToExon :Gene18_e3; affx:cdsType "Partial" ; affx:cdsStart "191136542" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene18_e22; affx:cdsType "Partial" ; affx:cdsStop "191215697" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e25; affx:cdsType "None" ] ; . :gi6746401 a affx:Transcript ; affx:unigene "iMm.4498" ; affx:translatesTo "MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSVLEGIRTRHPPIVVHCSAGVGRTGVVILSELMIYCLEHNEKVEVPTMLRFLREQRMFMIQTIAQYKFVYQVLVQFLQNSRLI" ; affx:hasCds [affx:startsAt "191136542" ; affx:stopsAt "191220061" ]; affx:hasExon [ affx:relatesToExon :Gene18_e2; affx:cdsType "Partial" ; affx:cdsStart "191136542" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene18_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene18_e24; affx:cdsType "Partial" ; affx:cdsStop "191220061" ; affx:frame "2"] ; . :Gene18_e1 a affx:Exon ; affx:startsAt "191136410" ; affx:stopsAt "191136716" ; affx:commonToAll "0" . :Gene18_e2 a affx:Exon ; affx:startsAt "191136439" ; affx:stopsAt "191136628" ; affx:commonToAll "0" . :Gene18_e3 a affx:Exon ; affx:startsAt "191136439" ; affx:stopsAt "191136716" ; affx:commonToAll "0" . :Gene18_e4 a affx:Exon ; affx:startsAt "191148176" ; affx:stopsAt "191148346" ; affx:commonToAll "0" . :Gene18_e5 a affx:Exon ; affx:startsAt "191172583" ; affx:stopsAt "191172681" ; affx:commonToAll "0" . :Gene18_e6 a affx:Exon ; affx:startsAt "191175024" ; affx:stopsAt "191175092" ; affx:commonToAll "0" . :Gene18_e7 a affx:Exon ; affx:startsAt "191182722" ; affx:stopsAt "191182793" ; affx:commonToAll "0" . :Gene18_e8 a affx:Exon ; affx:startsAt "191183312" ; affx:stopsAt "191183400" ; affx:commonToAll "0" . :Gene18_e9 a affx:Exon ; affx:startsAt "191186335" ; affx:stopsAt "191186424" ; affx:commonToAll "0" . :Gene18_e10 a affx:Exon ; affx:startsAt "191189532" ; affx:stopsAt "191189620" ; affx:commonToAll "0" . :Gene18_e11 a affx:Exon ; affx:startsAt "191190522" ; affx:stopsAt "191190605" ; affx:commonToAll "0" . :Gene18_e12 a affx:Exon ; affx:startsAt "191193222" ; affx:stopsAt "191193280" ; affx:commonToAll "0" . :Gene18_e13 a affx:Exon ; affx:startsAt "191196394" ; affx:stopsAt "191196473" ; affx:commonToAll "0" . :Gene18_e14 a affx:Exon ; affx:startsAt "191200084" ; affx:stopsAt "191200548" ; affx:commonToAll "0" . :Gene18_e15 a affx:Exon ; affx:startsAt "191200084" ; affx:stopsAt "191200733" ; affx:commonToAll "0" . :Gene18_e16 a affx:Exon ; affx:startsAt "191200084" ; affx:stopsAt "191201568" ; affx:commonToAll "0" . :Gene18_e17 a affx:Exon ; affx:startsAt "191204985" ; affx:stopsAt "191205129" ; affx:commonToAll "0" . :Gene18_e18 a affx:Exon ; affx:startsAt "191205066" ; affx:stopsAt "191205129" ; affx:commonToAll "0" . :Gene18_e19 a affx:Exon ; affx:startsAt "191206694" ; affx:stopsAt "191206913" ; affx:commonToAll "0" . :Gene18_e20 a affx:Exon ; affx:startsAt "191210518" ; affx:stopsAt "191210647" ; affx:commonToAll "0" . :Gene18_e21 a affx:Exon ; affx:startsAt "191213396" ; affx:stopsAt "191213631" ; affx:commonToAll "0" . :Gene18_e22 a affx:Exon ; affx:startsAt "191215564" ; affx:stopsAt "191215728" ; affx:commonToAll "0" . :Gene18_e23 a affx:Exon ; affx:startsAt "191215604" ; affx:stopsAt "191215728" ; affx:commonToAll "0" . :Gene18_e24 a affx:Exon ; affx:startsAt "191219932" ; affx:stopsAt "191220074" ; affx:commonToAll "0" . :Gene18_e25 a affx:Exon ; affx:startsAt "191219932" ; affx:stopsAt "191220078" ; affx:commonToAll "0" . :Gene18_e26 a affx:Exon ; affx:startsAt "191219932" ; affx:stopsAt "191220313" ; affx:commonToAll "0" . :Gene19 a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi199583] ; affx:hasVariant [affx:representedBy :gi6755115] . :gi199583 a affx:Transcript ; affx:unigene "iMm.3869" ; affx:translatesTo "MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHEGLHNGF" ; affx:hasCds [affx:startsAt "164443320" ; affx:stopsAt "164501966" ]; affx:hasExon [ affx:relatesToExon :Gene19_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene19_e2; affx:cdsType "Partial" ; affx:cdsStart "164443320" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene19_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene19_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene19_e6; affx:cdsType "Partial" ; affx:cdsStop "164501966" ; affx:frame "0"] ; . :gi6755115 a affx:Transcript ; affx:unigene "iMm.3869" ; affx:translatesTo "MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN" ; affx:hasCds [affx:startsAt "164437578" ; affx:stopsAt "164501966" ]; affx:hasExon [ affx:relatesToExon :Gene19_e1; affx:cdsType "Partial" ; affx:cdsStart "164437578" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene19_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene19_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene19_e5; affx:cdsType "Partial" ; affx:cdsStop "164501966" ; affx:frame "0"] ; . :Gene19_e1 a affx:Exon ; affx:startsAt "164437510" ; affx:stopsAt "164437717" ; affx:commonToAll "1" . :Gene19_e2 a affx:Exon ; affx:startsAt "164443303" ; affx:stopsAt "164443375" ; affx:commonToAll "0" . :Gene19_e3 a affx:Exon ; affx:startsAt "164447087" ; affx:stopsAt "164447269" ; affx:commonToAll "1" . :Gene19_e4 a affx:Exon ; affx:startsAt "164451166" ; affx:stopsAt "164451342" ; affx:commonToAll "1" . :Gene19_e5 a affx:Exon ; affx:startsAt "164501725" ; affx:stopsAt "164502107" ; affx:commonToAll "0" . :Gene19_e6 a affx:Exon ; affx:startsAt "164501725" ; affx:stopsAt "164502144" ; affx:commonToAll "0" . :Gene20 a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi1526418] ; affx:hasVariant [affx:representedBy :gi1526420] . :gi1526418 a affx:Transcript ; affx:unigene "iMm.4651" ; affx:translatesTo "MQGEDARYLKRKVKGGNIDVHPSEKALIVQYEVEATILGEMGDPMLGERKECQKIIRLKSLNANTDITSLARKVVEECKLIHPSKLSEVEQLLYYLQNRRDSLPGKEKKEKSSKPKDPPPFEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALARVLREDWKQSVELATNIIYIFFCFSSFSHFHGLITHYKIGALCMNIIDHELKRHELWQEELSKKKKAVDEDLENQTLRKDYDKTFKKYQGLVVKQEQLLRVALYLLLNLAEDTRTELKMRNKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDLLNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNENYKQIAMCVLYHISMDDRFKSMFAYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKLKDPLLMKMIRNISQHDGPTKNLFIDYVGDLAAQISSDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPFLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQLDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLITSEGAISPDFFNDFHLQNGDVVGQHAFPGSLGMDGFGQPLGILGRPATAYGFRPDEPYYYSFGSR" ; affx:hasCds [affx:startsAt "164969429" ; affx:stopsAt "165106021" ]; affx:hasExon [ affx:relatesToExon :Gene20_e1; affx:cdsType "Partial" ; affx:cdsStart "164969429" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e21; affx:cdsType "Partial" ; affx:cdsStop "165106021" ; affx:frame "2"] ; . :gi1526420 a affx:Transcript ; affx:unigene "iMm.4651" ; affx:translatesTo "MQGEDARYLKRKVKGGNIDVHPSEKALIVQYEVEATILGEMGDPMLGERKECQKIIRLKSLNANTDITSLARKVVEECKLIHPSKLSEVEQLLYYLQNRRDSLPGKEKKEKSSKPKDPPPFEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALARVLREDWKQSVELATNIIYIFFCFSSFSHFHGLITHYKIGALCMNIIDHELKRHELWQEELSKKKKAVDEDLENQTLRKDYDKTFKKYQGLVVKQEQLLRVALYLLLNLAEDTRTELKMRNKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDLLNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNENYKQIAMCVLYHISMDDRFKSMFAYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKLKDPLLMKMIRNISQHDGPTKNLFIDYVGDLAAQISSDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPFLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQLDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLITSEGAISPDFFNDFHLQNGDVVGQHAFPGSTVHPRISKCFASVH" ; affx:hasCds [affx:startsAt "164969429" ; affx:stopsAt "165102305" ]; affx:hasExon [ affx:relatesToExon :Gene20_e1; affx:cdsType "Partial" ; affx:cdsStart "164969429" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene20_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene20_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e20; affx:cdsType "Partial" ; affx:cdsStop "165102305" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene20_e21; affx:cdsType "None" ] ; . :Gene20_e1 a affx:Exon ; affx:startsAt "164969237" ; affx:stopsAt "164969461" ; affx:commonToAll "1" . :Gene20_e2 a affx:Exon ; affx:startsAt "164972543" ; affx:stopsAt "164972675" ; affx:commonToAll "1" . :Gene20_e3 a affx:Exon ; affx:startsAt "164983413" ; affx:stopsAt "164983568" ; affx:commonToAll "1" . :Gene20_e4 a affx:Exon ; affx:startsAt "164985449" ; affx:stopsAt "164985505" ; affx:commonToAll "1" . :Gene20_e5 a affx:Exon ; affx:startsAt "164986716" ; affx:stopsAt "164986858" ; affx:commonToAll "1" . :Gene20_e6 a affx:Exon ; affx:startsAt "165003882" ; affx:stopsAt "165003982" ; affx:commonToAll "1" . :Gene20_e7 a affx:Exon ; affx:startsAt "165005338" ; affx:stopsAt "165005463" ; affx:commonToAll "1" . :Gene20_e8 a affx:Exon ; affx:startsAt "165007346" ; affx:stopsAt "165007445" ; affx:commonToAll "1" . :Gene20_e9 a affx:Exon ; affx:startsAt "165015201" ; affx:stopsAt "165015380" ; affx:commonToAll "1" . :Gene20_e10 a affx:Exon ; affx:startsAt "165018646" ; affx:stopsAt "165018809" ; affx:commonToAll "1" . :Gene20_e11 a affx:Exon ; affx:startsAt "165038174" ; affx:stopsAt "165038275" ; affx:commonToAll "1" . :Gene20_e12 a affx:Exon ; affx:startsAt "165045960" ; affx:stopsAt "165046069" ; affx:commonToAll "1" . :Gene20_e13 a affx:Exon ; affx:startsAt "165047396" ; affx:stopsAt "165047509" ; affx:commonToAll "1" . :Gene20_e14 a affx:Exon ; affx:startsAt "165052135" ; affx:stopsAt "165052301" ; affx:commonToAll "1" . :Gene20_e15 a affx:Exon ; affx:startsAt "165052891" ; affx:stopsAt "165053017" ; affx:commonToAll "1" . :Gene20_e16 a affx:Exon ; affx:startsAt "165055619" ; affx:stopsAt "165055718" ; affx:commonToAll "1" . :Gene20_e17 a affx:Exon ; affx:startsAt "165058881" ; affx:stopsAt "165058967" ; affx:commonToAll "1" . :Gene20_e18 a affx:Exon ; affx:startsAt "165073565" ; affx:stopsAt "165073755" ; affx:commonToAll "1" . :Gene20_e19 a affx:Exon ; affx:startsAt "165078392" ; affx:stopsAt "165078492" ; affx:commonToAll "1" . :Gene20_e20 a affx:Exon ; affx:startsAt "165102259" ; affx:stopsAt "165102325" ; affx:commonToAll "0" . :Gene20_e21 a affx:Exon ; affx:startsAt "165105912" ; affx:stopsAt "165107288" ; affx:commonToAll "1" . :Rev1 a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi15617417] ; affx:hasVariant [affx:representedBy :gi6682364] . :gi15617417 a affx:Transcript ; affx:unigene "iMm.154309" ; affx:translatesTo "MRRGGWRKRTENDGWEKWGGYMAAKVQKLEEQFRTDAANQKDGTASAIFSGVAIYVNGYTDPSAEELRNLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKAGRLLSSAPYQLYTKPSAAQKSLNFNPVCKPEDPGPGPSNRAKQLNNRVNHIIKKIETESEVKANGLSSWNEDGVNDDFSFEDLEHTFPGRKQNGVMHPRDTAVIFNGHTHSSNGALKTQDCLVPVGNSVASRLSLDSTQEEKRAEKSNADFRDCTVQHLQHSTRSADALRSPHRTNSLSPSLHSNTKINGAHHSTVQGPSSTKSTSVLTLSKVAPSVPSKPSDCNFISDFYSRSRLHHISTWKCELTEFVNTLQRQSSGIFPGREKLKKVKTGRSSLVVTDTGTMSVLSSPRHQSCVMHVDMDCFFVSVGIRNRPDLKGKPVAVTSNRGTGTAPLRPGANPQLEWQYYQNRALRGKAADIPDSSVWENQDSTQTNGIDSVLSKAEIASCSYEARQVGIKNGMFFGYAKQLCPNLQAVPYDFHACREVAQAMYETLASYTHSIEAVSCDEALIDVTDILAETKLSPEEFAAALRIEIKDKTKCAASVGIGSNILLARMATKKAKPDGQYHLQPDEVDDFIRGQLVTNLPGVGRSMESKLASLGIKTCGDLQCLTMAKLQKEFGPKTGQMLYRFCRGLDDRPVRTEKERKSVSAEINYGIRFTQPKEAEAFLLSLSEEIQRRLEAAGMKGKRLTLKIMVRKPGAPIETAKFGGHGICDNIARTVTLDQATDSAKIIGKATLNMFHTMKLNISDMRGVGIQVNQLVPANSNLSTCSSRPSAQSSLFSGRPHSVRDLFQLQKAKKPTEEEHKEVFLAAVDLEVSSTSRACGLLSPLSAHLAASVSPDTNSGECSRKWNGLHSPVSGQSRLNLSIEVPSPSQIDQSVLEALPLDLREQIEQVCAAQQGEPRGKKKEPVNGCSSGVLPHPVGTVLLQIPEPQEPCNSDSKISVIALPAFSQVDPDVFAALPAELQKELKAAYDQRQRQGEDTTHQQPTSTSVPKNPLLQLKPPAMKDKRNKRKNLIGSPRKSPLKNKLLSSPAKTLPGAYGSPQKLMDGFLQHEGMASERPLEEVSASTPGAQDLSSLLPGQSSCFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT" ; affx:hasCds [affx:startsAt "38559516" ; affx:stopsAt "38614903" ]; affx:hasExon [ affx:relatesToExon :Rev1_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rev1_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rev1_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rev1_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rev1_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e21; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e22; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e24; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e25; affx:cdsType "Full" ; affx:frame "2"] ; . :gi6682364 a affx:Transcript ; affx:unigene "iMm.154309" ; affx:translatesTo "MRRGGWRKRTENDGWEKWGGYMAAKVQKLEEQFRTDAANQKDGTASAIFSGVAIYVNGYTDPSAEELRNLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKAGRLLSSAPYQLYTKPSAAQKSLNFNPVCKPEDPGPGPSNRAKQLNNRVNHIIKKIETESEVKANGLSSWNEDGVNDDFSFEDLEHTFPGRKQNGVMHPRDTAVIFNGHTHSSNGALKTQDCLVPVGNSVASRLSLDSTQEEKRAEKSNADFRDCTVQHLQHSTRSADALRSPHRTNSLSPSLHSNTKINGAHHSTVQGPSSTKSTSVLTLSKVAPSVPSKPSDCNFISDFYSRSRLHHISTWKCELTEFVNTLQRQSSGIFPGREKLKKVKTGRSSLVVTDTGTMSVLSSPRHQSCVMHVDMDCFFVSVGIRNRPDLTGKPVAVTSNRGTGTAPLRPGANPQLEWQYYQNRALRGKAADIPDSSVWENQDSTQTNGIDSVLSKAEIASCSYEARQVGIKNGMFFGYAKQLCPNLQAVPYDFHACREVAQAMYETLASYTHSIEAVSCDEALIDVTDILAETKLSPEEFAAALRIEIKDKTKCAASVGIGSNILLARMATKKAKPDGQYHLQPDEVDDFIRGQLVTNLPGVGRSMESKLASLGIKTCGDLQCLTMAKLQKEFGPKTGQMLYRFCRGLDDRPVRTEKERKSVSAEINYGIRFTQPKEAEAFLLSLSEEIQRRLEAAGMKGKRLTLKIMVRKPGAPIETAKFGGHGICDNIARTVTLDQATDSAKIIGKATLNMFHTMKLNISDMRGVGIQVNQLVPANSNLSTCSSRPSAQSSLFSGRPHSVRDLFQLQKAKKPTEEEHKEVFLAAVDLEVSSTSRACGLLSPLSAHLAASVSPDTNSGECSRKWNGLHSPVSGQSRLNLSIEVPSPSQIDQSVLEALPLDLREQIEQVCAAQQGEPRGKKKEPVNGCSSGVLPHPVGTVLLQIPEPQEPCNSDSKISVIALPAFSQVDPDVFAALPAELQKELKAAYDQRQRQGEDTTHQQPTSTSVPKNPLLQLKPPAMKDKRNKRKNLIGSPRKSPLKNKLLSSPAKTLPGAYGSPQKLMDGFLQHEGMASERPLEEVSASTPGAQDLSSLLPGQSSCFRPAAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVRYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT" ; affx:hasCds [affx:startsAt "38559516" ; affx:stopsAt "38614903" ]; affx:hasExon [ affx:relatesToExon :Rev1_e1; affx:cdsType "Partial" ; affx:cdsStart "38559516" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rev1_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rev1_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rev1_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rev1_e20; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rev1_e21; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e22; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rev1_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e24; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rev1_e25; affx:cdsType "Full" ; affx:frame "2"] ; . :Rev1_e1 a affx:Exon ; affx:startsAt "38559447" ; affx:stopsAt "38559628" ; affx:commonToAll "0" . :Rev1_e2 a affx:Exon ; affx:startsAt "38559516" ; affx:stopsAt "38559628" ; affx:commonToAll "0" . :Rev1_e3 a affx:Exon ; affx:startsAt "38560045" ; affx:stopsAt "38560148" ; affx:commonToAll "1" . :Rev1_e4 a affx:Exon ; affx:startsAt "38560269" ; affx:stopsAt "38560426" ; affx:commonToAll "1" . :Rev1_e5 a affx:Exon ; affx:startsAt "38560513" ; affx:stopsAt "38560725" ; affx:commonToAll "1" . :Rev1_e6 a affx:Exon ; affx:startsAt "38561174" ; affx:stopsAt "38561295" ; affx:commonToAll "1" . :Rev1_e7 a affx:Exon ; affx:startsAt "38561720" ; affx:stopsAt "38561954" ; affx:commonToAll "1" . :Rev1_e8 a affx:Exon ; affx:startsAt "38562693" ; affx:stopsAt "38562896" ; affx:commonToAll "1" . :Rev1_e9 a affx:Exon ; affx:startsAt "38563146" ; affx:stopsAt "38563312" ; affx:commonToAll "1" . :Rev1_e10 a affx:Exon ; affx:startsAt "38564103" ; affx:stopsAt "38564206" ; affx:commonToAll "1" . :Rev1_e11 a affx:Exon ; affx:startsAt "38565551" ; affx:stopsAt "38565724" ; affx:commonToAll "1" . :Rev1_e12 a affx:Exon ; affx:startsAt "38569545" ; affx:stopsAt "38569766" ; affx:commonToAll "1" . :Rev1_e13 a affx:Exon ; affx:startsAt "38573930" ; affx:stopsAt "38574050" ; affx:commonToAll "1" . :Rev1_e14 a affx:Exon ; affx:startsAt "38577773" ; affx:stopsAt "38577928" ; affx:commonToAll "1" . :Rev1_e15 a affx:Exon ; affx:startsAt "38580747" ; affx:stopsAt "38580876" ; affx:commonToAll "1" . :Rev1_e16 a affx:Exon ; affx:startsAt "38585723" ; affx:stopsAt "38585832" ; affx:commonToAll "1" . :Rev1_e17 a affx:Exon ; affx:startsAt "38590137" ; affx:stopsAt "38590254" ; affx:commonToAll "0" . :Rev1_e18 a affx:Exon ; affx:startsAt "38590137" ; affx:stopsAt "38590261" ; affx:commonToAll "0" . :Rev1_e19 a affx:Exon ; affx:startsAt "38591978" ; affx:stopsAt "38592086" ; affx:commonToAll "0" . :Rev1_e20 a affx:Exon ; affx:startsAt "38591985" ; affx:stopsAt "38592086" ; affx:commonToAll "0" . :Rev1_e21 a affx:Exon ; affx:startsAt "38594404" ; affx:stopsAt "38595108" ; affx:commonToAll "1" . :Rev1_e22 a affx:Exon ; affx:startsAt "38598499" ; affx:stopsAt "38598652" ; affx:commonToAll "1" . :Rev1_e23 a affx:Exon ; affx:startsAt "38605298" ; affx:stopsAt "38605467" ; affx:commonToAll "1" . :Rev1_e24 a affx:Exon ; affx:startsAt "38614013" ; affx:stopsAt "38614140" ; affx:commonToAll "1" . :Rev1_e25 a affx:Exon ; affx:startsAt "38614849" ; affx:stopsAt "38614903" ; affx:commonToAll "1" . :Gene22 a affx:Gene ; affx:strand "+" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi13529385] ; affx:hasVariant [affx:representedBy :gi6678102] . :gi13529385 a affx:Transcript ; affx:unigene "iMm.4622" ; affx:translatesTo "MDALRLANSAFAVDLFKQLCERDPAGNILFSPICLSTSLSLAQVGTKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLVKRLYIDKSLNPSTEFISSTKRPYAKELETVDFKDKLEETKGQINSSIKELTDGHFEDILSENSISDQTKILVVNAAYFVGKWMKKFPESETKECPFRISKTDTKPVQMMNLEATFCLGNIDDISCKIIELPFQNKHLSMLIVLPKDVEDESTGLEKIEQQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNESTSDFSGMSETKGVSLSNVIHRVCLEITEDGGESIEVPGSRILQHKDEFNADHPFIYIIRHNKTRNIIFFGKFCSP" ; affx:hasCds [affx:startsAt "107442266" ; affx:stopsAt "107453977" ]; affx:hasExon [ affx:relatesToExon :Gene22_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene22_e4; affx:cdsType "Partial" ; affx:cdsStart "107442266" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene22_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene22_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene22_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene22_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene22_e10; affx:cdsType "Partial" ; affx:cdsStop "107453977" ; affx:frame "2"] ; . :gi6678102 a affx:Transcript ; affx:unigene "iMm.4622" ; affx:translatesTo "MDALRLANSAFAVDLFKQLCERDPAGNILFSPICLSTSLSLAQVGTKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLVKRLYIDKSLNPSTEFISSTKRPYAKELETVDFKDKLEETKGQINSSIKELTDGHFEDILSENSISDQTKILVVNAAYFVGKWMKKFPESETKECPFRISKTDTKPVQMMNLEATFCLGNIDDISCKIIELPFQNKHLSMLIVLPKDVEDESTGLEKIEQQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNESTSDFSGMSETKGVSLSNVIHRVCLEITEDGGESIEVPGSRILQHKDEFNADHPFIYIIRHNKTRNIIFFGKFCSP" ; affx:hasCds [affx:startsAt "107442266" ; affx:stopsAt "107453977" ]; affx:hasExon [ affx:relatesToExon :Gene22_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene22_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene22_e4; affx:cdsType "Partial" ; affx:cdsStart "107442266" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene22_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene22_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene22_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene22_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene22_e9; affx:cdsType "Partial" ; affx:cdsStop "107453977" ; affx:frame "2"] ; . :Gene22_e1 a affx:Exon ; affx:startsAt "107433163" ; affx:stopsAt "107433244" ; affx:commonToAll "0" . :Gene22_e2 a affx:Exon ; affx:startsAt "107433186" ; affx:stopsAt "107433244" ; affx:commonToAll "0" . :Gene22_e3 a affx:Exon ; affx:startsAt "107441462" ; affx:stopsAt "107441592" ; affx:commonToAll "0" . :Gene22_e4 a affx:Exon ; affx:startsAt "107442265" ; affx:stopsAt "107442434" ; affx:commonToAll "1" . :Gene22_e5 a affx:Exon ; affx:startsAt "107444233" ; affx:stopsAt "107444371" ; affx:commonToAll "1" . :Gene22_e6 a affx:Exon ; affx:startsAt "107447026" ; affx:stopsAt "107447144" ; affx:commonToAll "1" . :Gene22_e7 a affx:Exon ; affx:startsAt "107447993" ; affx:stopsAt "107448136" ; affx:commonToAll "1" . :Gene22_e8 a affx:Exon ; affx:startsAt "107452159" ; affx:stopsAt "107452327" ; affx:commonToAll "1" . :Gene22_e9 a affx:Exon ; affx:startsAt "107453584" ; affx:stopsAt "107454092" ; affx:commonToAll "0" . :Gene22_e10 a affx:Exon ; affx:startsAt "107453584" ; affx:stopsAt "107455332" ; affx:commonToAll "0" . :Gene23 a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi13938027] ; affx:hasVariant [affx:representedBy :gi3077735] . :gi13938027 a affx:Transcript ; affx:unigene "iMm.8575" ; affx:translatesTo "MVNCTIKSEEKKEPCHEAPQGAAPAVETQPGDPALASQDATNAKAPPQDCASPESSGSPEPKRPAASEAASGSQERLDFNRNLQEVVPAIEKLLSSDWKERFLGRSNVEAKDVKGTQESLAEKELQLLVMIHQLSALRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRSGVAAHHPLQEPPQPLNLTAKPKVPELPNTSSSPSLKMNSCGPRPASHGAPTRDLQSSPPSLPLGFLGEGDAVTKAIQDARQLLHSHSGALENSPNTPFRKDLISLDSSPAKERLEESCVHPLEEAMLSCDMDGSRHFSESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCVVEGRRLRVGEYKALMRTRRQGARQSYTIPPQAGQAQVSSDILFPRAAGLPLARPLVEHYDPQGLDPNMPVIINTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGDEKSDEELVVLTD" ; affx:hasCds [affx:startsAt "134237949" ; affx:stopsAt "134247515" ]; affx:hasExon [ affx:relatesToExon :Gene23_e1; affx:cdsType "Partial" ; affx:cdsStart "134237949" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene23_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene23_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene23_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene23_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene23_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene23_e17; affx:cdsType "Partial" ; affx:cdsStop "134247515" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e18; affx:cdsType "None" ] ; . :gi3077735 a affx:Transcript ; affx:unigene "iMm.8575" ; affx:translatesTo "MVNCTIKSEEKKEPCHEAPQGAAPAVETQPGDPALASQDATNAKAPPQDCASPESSGSPEPKRPAASEAASGSQERLDFNRNLQEVVPAIEKLLSSDWKERFLGRSNVEAKDVKGTQESLAEKELQLLVMIHQLSALRDQLLTAHSEQKNMAAMLFEKQQQQMELARQQQEQIAKQQQQLIQQQHKINLLQQQIQQVNMPYVMIPAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRSGVAAHHPLQEPPQPLNLTAKPKVPELPNTSSSPSLKMNSCGPRPASHGAPTRDLQSSPPSLPLGFLGEGDAVTKAIQDARQLLHSHSGALENSPNTPFRKDLISLDSSPAKERLEESCVHPLEEAMLSCDMDGSRHFSESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCVVEGRRLRVGEYKALMRTRRQGARQSYTIPPQAGQAQVSSDILFPRAAGLPLARPLVEHYDPQGLDPNMPVIINTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGDEKSDEELVVLTD" ; affx:hasCds [affx:startsAt "134237949" ; affx:stopsAt "134247515" ]; affx:hasExon [ affx:relatesToExon :Gene23_e2; affx:cdsType "Partial" ; affx:cdsStart "134237949" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene23_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene23_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene23_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene23_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene23_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene23_e16; affx:cdsType "Partial" ; affx:cdsStop "134247515" ; affx:frame "2"] ; . :Gene23_e1 a affx:Exon ; affx:startsAt "134236602" ; affx:stopsAt "134238223" ; affx:commonToAll "0" . :Gene23_e2 a affx:Exon ; affx:startsAt "134236603" ; affx:stopsAt "134238223" ; affx:commonToAll "0" . :Gene23_e3 a affx:Exon ; affx:startsAt "134238755" ; affx:stopsAt "134238972" ; affx:commonToAll "1" . :Gene23_e4 a affx:Exon ; affx:startsAt "134239764" ; affx:stopsAt "134239908" ; affx:commonToAll "1" . :Gene23_e5 a affx:Exon ; affx:startsAt "134240292" ; affx:stopsAt "134240389" ; affx:commonToAll "1" . :Gene23_e6 a affx:Exon ; affx:startsAt "134240483" ; affx:stopsAt "134240593" ; affx:commonToAll "1" . :Gene23_e7 a affx:Exon ; affx:startsAt "134241064" ; affx:stopsAt "134241227" ; affx:commonToAll "1" . :Gene23_e8 a affx:Exon ; affx:startsAt "134241382" ; affx:stopsAt "134241465" ; affx:commonToAll "1" . :Gene23_e9 a affx:Exon ; affx:startsAt "134242747" ; affx:stopsAt "134242862" ; affx:commonToAll "1" . :Gene23_e10 a affx:Exon ; affx:startsAt "134243227" ; affx:stopsAt "134243296" ; affx:commonToAll "1" . :Gene23_e11 a affx:Exon ; affx:startsAt "134243622" ; affx:stopsAt "134243795" ; affx:commonToAll "1" . :Gene23_e12 a affx:Exon ; affx:startsAt "134244857" ; affx:stopsAt "134244944" ; affx:commonToAll "0" . :Gene23_e13 a affx:Exon ; affx:startsAt "134244857" ; affx:stopsAt "134244946" ; affx:commonToAll "0" . :Gene23_e14 a affx:Exon ; affx:startsAt "134245027" ; affx:stopsAt "134245139" ; affx:commonToAll "0" . :Gene23_e15 a affx:Exon ; affx:startsAt "134245029" ; affx:stopsAt "134245139" ; affx:commonToAll "0" . :Gene23_e16 a affx:Exon ; affx:startsAt "134247371" ; affx:stopsAt "134247560" ; affx:commonToAll "0" . :Gene23_e17 a affx:Exon ; affx:startsAt "134247371" ; affx:stopsAt "134247570" ; affx:commonToAll "0" . :Gene23_e18 a affx:Exon ; affx:startsAt "134278174" ; affx:stopsAt "134278333" ; affx:commonToAll "0" . :MusSox17 a affx:Gene ; affx:strand "-" ; affx:chr "chr1" ; affx:hasVariant [affx:representedBy :gi1487865] ; affx:hasVariant [affx:representedBy :gi6755603] . :gi1487865 a affx:Transcript ; affx:unigene "iMm.5080" ; affx:translatesTo "MQDHPNYKYRPRRRKQVKRMKRVEGGFLHALVEPQAGALGPEGGRVAMDGLGLPFPEPGYPAGP