# Test data in notation3 http://www.w3.org/DesignIssues/Notation3.html
#    
@prefix affx: <http://www.affymetrix.com/community/publications/affymetrix/tmsplice#> .
@prefix rdfs: <http://www.w3.org/2000/01/rdf-schema#> .
@prefix owl: <http://www.w3.org/2002/07/owl#> .

@prefix : <#> .

affx:Gene a owl:Class ;
    	owl:hasProperty affx:onStrand ;
    	owl:hasProperty affx:onChr ;
    	owl:hasProperty affx:hasVariant .

affx:onStrand a owl:ObjectProperty ;
	owl:domain affx:Gene ; 
    	owl:range rdfs:Literal ;
	owl:cardinality "1" ;
    	rdfs:comment "The strand on which the gene exists" .

affx:onChr a owl:ObjectProperty ;
	owl:domain affx:Gene ;
	owl:range rdfs:Literal ;
	owl:cardinality "1" ;
	rdfs:comment "The chromosome on which the gene exists" .

affx:hasVariant a owl:ObjectProperty ;
	owl:domain affx:Gene ;
	owl:range affx:SpliceVariant ;
	owl:minCardinality "1" ;
	rdfs:comment "For associating variants to genes" .

affx:SpliceVariant a owl:Class ;
        owl:hasProperty affx:representedBy .

affx:representedBy a owl:ObjectProperty ;
	owl:domain affx:SpliceVariant ;
	owl:range affx:Transcript ;
	owl:minCardinality "1" ;
	rdfs:comment 
	 "In this data, each splice variant is represented by one transcript" .

affx:Transcript a owl:Class ;
	owl:hasProperty affx:unigene ;
	owl:hasProperty affx:translatesTo ;
	owl:hasProperty affx:fullCds ;
	owl:hasProperty affx:hasExon ;
	owl:hasProperty affx:signalPHit ;
	owl:hasProperty affx:tmHMMHit ;
	rdfs:comment 
	   "A transcript has a CDS region, a protein translation, and exons" ;
	rdfs:comment
	   "Additionally the transcript might have one or more annotations" . 

affx:unigene a owl:ObjectProperty ;
	owl:domain affx:Transcript ;
	owl:range rdfs:Literal ;
	owl:cardinality "1" ;
	rdfs:comment "The Unigene ID of the transcript - and splice variant" .

affx:translatesTo a owl:ObjectProperty ;
	owl:domain affx:Transcript ;
	owl:range rdfs:Literal ;
	owl:cardinality "1" ;
	rdfs:comment "The amino acid sequence derived from the transcript" .

affx:fullCds a owl:ObjectProperty ;
	owl:domain affx:Transcript ;
	owl:range affx:GenomicCoordinates ;
	owl:cardinality "1" ;
	rdfs:comment "Start and stop coordinates of the full CDS region" .

affx:hasExon a owl:ObjectProperty ;
	owl:domain affx:Transcript ;
	owl:range affx:ExonPlusCds ;
	owl:minCardinality "1" ;
	rdfs:comment "Here, exons are defined only by their coordinates " .

affx:ExonPlusCds a owl:Class ;
	owl:hasProperty affx:relatesToExon ;
	owl:hasProperty affx:cdsType ;	
	owl:hasProperty affx:cdsStart ;
	owl:hasProperty affx:cdsStop ;
	owl:hasProperty affx:frame .
	
affx:relatesToExon a owl:ObjectProperty ;
	owl:domain affx:ExonWithCds ; 
	owl:range affx:Exon ;
	owl:cardinality "1" ;
	rdfs:comment "For associating exons with properties such as frame" .

affx:Exon a owl:Class ;
	rdfs:subClassOf affx:GenomicSpan ;
	owl:hasProperty affx:commonToAll ;
	rdfs:comment "Defines the coordinates of an exon on the genome" .

affx:GenomicSpan a owl:Class ;
	rdfs:subClassOf affx:GenomicCoordinates ;
	rdfs:comment "This defines a region of _ungapped_ genomic alignment" .

affx:GenomicCoordinates a owl:Class ;
	rdfs:subClassOf affx:Coordinates ;
	rdfs:comment "Start and stop, possibly with intervening gaps " ;
	rdfs:comment "Strand and chr will be specified at the gene level " .

affx:Coordinates a owl:Class ;
	owl:hasProperty affx:startsAt ;
	owl:hasProperty affx:stopsAt .

affx:startsAt a owl:ObjectProperty ;
	owl:cardinality "1" ;
	owl:range rdfs:Literal .

affx:stopsAt a owl:ObjectProperty ;
	owl:cardinality "1" ;
	owl:range rdfs:Literal .

affx:cdsType a owl:ObjectProperty ;
	owl:domain affx:ExonPlusCds ;
	owl:range rdfs:Literal ;
	rdfs:comment "Expected CDS types are Full, Partial, and None" .

affx:commonToAll a owl:ObjectProperty ;
	owl:range rdfs:Literal ;
	owl:cardinality "1" ;
	rdfs:comment "Shows if all the gene's variants share this object" .

affx:CdsOccupancy a owl:Class ;
	rdfs:subClassOf rdfs:Literal .

affx:cdsStart a owl:ObjectProperty ;
	rdfs:subClassOf affx:startsAt ;
	rdfs:comment "For indicating where a specific CDS region starts" .

affx:cdsStop a owl:ObjectProperty ;
	rdfs:subClassOf affx:stopsAt ;
	rdfs:comment "For indicating where a specific CDS region stops" .

affx:frame a owl:ObjectProperty ;
	owl:range rdfs:Literal ;
	owl:cardinality "1" .

affx:signalPHit a owl:ObjectProperty ;
	rdfs:domain affx:Transcript ;
	rdfs:range affx:SignalPeptide ;
	owl:cardinality "1" .

affx:SignalPeptide a owl:Class ;
	rdfs:subClassOf affx:Annotation ;
	rdfs:comment "Represents a SIGNALP hit" .

affx:tmHMMHit a owl:ObjectProperty ;
	rdfs:domain affx:Transcript ;
	rdfs:range affx:Transmembrane ;
	owl:cardinality "1" .

affx:Transmembrane a owl:Class ;
	rdfs:subClassOf affx:Annotation ;
	owl:hasProperty affx:helixCount ;
	rdfs:comment "Represents a TMHMM hit" .

affx:Annotation a owl:Class ;
	owl:hasProperty affx:containsMotif;
	owl:hasProperty affx:commonToAll ;
	owl:hasProperty affx:motifCount .

affx:containsMotif a owl:ObjectProperty ;
	owl:domain affx:Annotation ;
	owl:range affx:Motif ;
	owl:minCardinality "1" .

affx:motifCount a owl:ObjectProperty ;
	owl:domain affx:Annotation ;
	owl:range rdfs:Literal ;
	owl:cardinality "1" ;
	rdfs:comment "Number of motifs (eg. TM passes) in this annotation" .

affx:Motif a owl:Class ;
	owl:hasProperty affx:hasProteinSpan .

affx:hasProteinSpan a owl:ObjectProperty ;
	owl:domain affx:Motif ;
	owl:range affx:ProteinSpan .

affx:ProteinCoordinates a owl:Class ;
	rdfs:subClassOf affx:Coordinates ;
	rdfs:comment "Coordinates onto the protein sequence, possibly gapped ".

affx:spannedBy a owl:ObjectProperty ;
	owl:domain affx:ProteinSpan ;
	owl:range affx:CdsSpan ;
	owl:minCardinality "1" .

affx:ProteinSpan a owl:Class ;
	rdfs:subClassOf affx:ProteinCoordinates ;
	owl:hasProperty affx:spannedBy ;
	rdfs:comment "An ungapped region of the protein sequence " ;
	rdfs:comment "Each ProteinSpan as one or more corresponding CDS span" .

affx:CdsSpan a owl:Class ;
	rdfs:subClassOf affx:GenomicSpan ;
	owl:hasProperty affx:inFrame ;
	rdfs:comment "A CDS span is a genomic span with a translation frame" ;
	rdfs:comment "Each CDS span describes a part of the full CDS region" .

:Pcdh12 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi8393915] .

:gi8393915 a affx:Transcript ;
	affx:unigene "iMm.12862" ;
	affx:translatesTo "MMLLLPFLLGLLGPGSYLFISGDCQEVATVMVKFQVTEEVPSGTVIGKLSQELRVEERRGKAGDAFQILQLPQALPVQMNSEDGLLSTSSRLDREKLCRQEDPCLVSFDVLATGASALIHVEIQVLDINDHQPQFPKDEQELEISESASLHTRIPLDRALDQDTGPNSLYSYSLSPSEHFALDVIVGPDETKHAELVVVKELDRELHSYFDLVLTAYDNGNPPKSGISVVKVNVLDSNDNSPVFAESSLALEIPEDTVPGTLLINLTATDPDQGPNGEVEFFFGKHVSPEVMNTFGIDAKTGQIILRQALDYEKNPAYEVDVQARDLGPNSIPGHCKVLIKVLDVNDNAPSILITWASQTSLVSEDLPRDSFIALVSANDLDSGNNGLVHCWLNQELGHFRLKRTNGNTYMLLTNATLDREQWPIYTLTVFAQDQGPQPLSAEKELQIQVSDVNDNAPVFEKSRYEVSTWENNPPSLHLITLKAHDADLGSNGKVSYRIKDSPVSHLVIIDFETGEVTAQRSLDYEQMAGFEFQVIAEDRGQPQLASSISVWVSLLDANDNAPEVIQPVLSEGKATLSVLVNASTGHLLLPIENPSGMDPAGTGIPPKATHSPWSFLLLTIVARDADSGANGELFYSIQSGNDAHLFFLSPSLGQLFINVTNASSLIGSQWDLGIVVEDQGSPSLQTQVSLKVVFVTSVDHLRDSAHEPGVLSTPALALICLAVLLAIFGLLLALFVSICRTERKDNRAYNCREAESSYRHQPKRPQKHIQKADIHLVPVLRAHENETDEVRPSHKDTSKETLMEAGWDSCLQAPFHLTPTLYRTLRNQGNQGELAESQEVLQDTFNFLFNHPRQRNASRENLNLPESPPAVRQPLLRPLKVPGSPIARATGDQDKEEAPQSPPASSATLRRQRNFNGKVSPRGESGPHQILRSLVRLSVAAFAERNPVEEPAGDSPPVQQISQLLSLLHQGQFQPKPNHRGNKYLAKPGGSSRGTIPDTEGLVGLKPSGQAEPDLEEGPPSPEEDLSVKRLLEEELSSLLDPNTGLALDKLSPPDPAWMARLSLPLTTNYRDNLSSPDATTSEEPRTFQTFGKTVGPGPELSPTGTRLASTFVSEMSSLLEMLLGQHTVPVEAASAALRRLSVCGRTLSLDLATSGASASEAQGRKKAAESRLGCGRNL" ;
	affx:hasCds [affx:startsAt "38456058" ;
			affx:stopsAt "38471326" ];
	affx:hasExon [ affx:relatesToExon :Pcdh12_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "38456058" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Pcdh12_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Pcdh12_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Pcdh12_e4;
		affx:cdsType "Partial" ;
		affx:cdsStop "38471326" ;
		affx:frame "2"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "17" ;
				affx:spannedBy [ affx:startsAt "38471275" ;
					affx:stopsAt "38471326" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "716" ;
				affx:stopsAt "738" ;
				affx:spannedBy [ affx:startsAt "38469112" ;
					affx:stopsAt "38469178" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	.

:Pcdh12_e1 a affx:Exon ; 
	affx:startsAt "38456029" ; 
	affx:stopsAt "38456465" ; 
	affx:commonToAll "1" .

:Pcdh12_e2 a affx:Exon ; 
	affx:startsAt "38462571" ; 
	affx:stopsAt "38462726" ; 
	affx:commonToAll "1" .

:Pcdh12_e3 a affx:Exon ; 
	affx:startsAt "38465083" ; 
	affx:stopsAt "38465184" ; 
	affx:commonToAll "1" .

:Pcdh12_e4 a affx:Exon ; 
	affx:startsAt "38468446" ; 
	affx:stopsAt "38471613" ; 
	affx:commonToAll "1" .

:Pdgfrb a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi6679258] .

:gi6679258 a affx:Transcript ;
	affx:unigene "iMm.4146" ;
	affx:translatesTo "MGLPGVIPALVLKGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALPVGFSLPSHLNLTGESDGGYMDMSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDYIIPLPDPKPDVADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQPQDSGCPGPLAEAEDSFL" ;
	affx:hasCds [affx:startsAt "61354172" ;
			affx:stopsAt "61377091" ];
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "61354172" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e4;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e5;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e6;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e7;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e8;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e9;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e10;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e11;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e12;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e13;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e14;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e15;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e16;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e17;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e18;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e19;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e20;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e21;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e22;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Pdgfrb_e23;
		affx:cdsType "Partial" ;
		affx:cdsStop "61377091" ;
		affx:frame "1"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "31" ;
				affx:spannedBy [ affx:startsAt "61354172" ;
					affx:stopsAt "61354205" ;
					affx:inFrame "0" ] ;
				affx:spannedBy [ affx:startsAt "61355220" ;
					affx:stopsAt "61355280" ;
					affx:inFrame "1" ] ;
			] ;
		] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "533" ;
				affx:stopsAt "555" ;
				affx:spannedBy [ affx:startsAt "61365384" ;
					affx:stopsAt "61365450" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	.

:Pdgfrb_e1 a affx:Exon ; 
	affx:startsAt "61339419" ; 
	affx:stopsAt "61339551" ; 
	affx:commonToAll "1" .

:Pdgfrb_e2 a affx:Exon ; 
	affx:startsAt "61354166" ; 
	affx:stopsAt "61354205" ; 
	affx:commonToAll "1" .

:Pdgfrb_e3 a affx:Exon ; 
	affx:startsAt "61355220" ; 
	affx:stopsAt "61355548" ; 
	affx:commonToAll "1" .

:Pdgfrb_e4 a affx:Exon ; 
	affx:startsAt "61357567" ; 
	affx:stopsAt "61357834" ; 
	affx:commonToAll "1" .

:Pdgfrb_e5 a affx:Exon ; 
	affx:startsAt "61358497" ; 
	affx:stopsAt "61358625" ; 
	affx:commonToAll "1" .

:Pdgfrb_e6 a affx:Exon ; 
	affx:startsAt "61358705" ; 
	affx:stopsAt "61358880" ; 
	affx:commonToAll "1" .

:Pdgfrb_e7 a affx:Exon ; 
	affx:startsAt "61359415" ; 
	affx:stopsAt "61359608" ; 
	affx:commonToAll "1" .

:Pdgfrb_e8 a affx:Exon ; 
	affx:startsAt "61360198" ; 
	affx:stopsAt "61360314" ; 
	affx:commonToAll "1" .

:Pdgfrb_e9 a affx:Exon ; 
	affx:startsAt "61361796" ; 
	affx:stopsAt "61361920" ; 
	affx:commonToAll "1" .

:Pdgfrb_e10 a affx:Exon ; 
	affx:startsAt "61362445" ; 
	affx:stopsAt "61362657" ; 
	affx:commonToAll "1" .

:Pdgfrb_e11 a affx:Exon ; 
	affx:startsAt "61365361" ; 
	affx:stopsAt "61365456" ; 
	affx:commonToAll "1" .

:Pdgfrb_e12 a affx:Exon ; 
	affx:startsAt "61366330" ; 
	affx:stopsAt "61366463" ; 
	affx:commonToAll "1" .

:Pdgfrb_e13 a affx:Exon ; 
	affx:startsAt "61366941" ; 
	affx:stopsAt "61367046" ; 
	affx:commonToAll "1" .

:Pdgfrb_e14 a affx:Exon ; 
	affx:startsAt "61367328" ; 
	affx:stopsAt "61367439" ; 
	affx:commonToAll "1" .

:Pdgfrb_e15 a affx:Exon ; 
	affx:startsAt "61370226" ; 
	affx:stopsAt "61370386" ; 
	affx:commonToAll "1" .

:Pdgfrb_e16 a affx:Exon ; 
	affx:startsAt "61371325" ; 
	affx:stopsAt "61371486" ; 
	affx:commonToAll "1" .

:Pdgfrb_e17 a affx:Exon ; 
	affx:startsAt "61372236" ; 
	affx:stopsAt "61372355" ; 
	affx:commonToAll "1" .

:Pdgfrb_e18 a affx:Exon ; 
	affx:startsAt "61372585" ; 
	affx:stopsAt "61372708" ; 
	affx:commonToAll "1" .

:Pdgfrb_e19 a affx:Exon ; 
	affx:startsAt "61373331" ; 
	affx:stopsAt "61373443" ; 
	affx:commonToAll "1" .

:Pdgfrb_e20 a affx:Exon ; 
	affx:startsAt "61374003" ; 
	affx:stopsAt "61374103" ; 
	affx:commonToAll "1" .

:Pdgfrb_e21 a affx:Exon ; 
	affx:startsAt "61374662" ; 
	affx:stopsAt "61374768" ; 
	affx:commonToAll "1" .

:Pdgfrb_e22 a affx:Exon ; 
	affx:startsAt "61375524" ; 
	affx:stopsAt "61375757" ; 
	affx:commonToAll "1" .

:Pdgfrb_e23 a affx:Exon ; 
	affx:startsAt "61376928" ; 
	affx:stopsAt "61378767" ; 
	affx:commonToAll "1" .

:Ndst1 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi6680312] .

:gi6680312 a affx:Transcript ;
	affx:unigene "iMm.42245" ;
	affx:translatesTo "MPALACLRRLCRHLSPQAVLFLLFVFCLFSVFVSAYYLYGWNRGLEPSADASESDCGDPPPVAPSRLLPIKPVQAVAPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALIIYENILKYVNLDAWNRELLDKYCVAYGVGIIGFFKANENSLLSAQLKGFPLFLHSNLGLKDCSINPKSPLLYVTRPSEVEKGVLPGEDWTVFQSNHSTYEPVLLAKTRSSESIPHLGADAGLHAALHATVVQDLGLHDGIQRVLFGNNLNFWLHKLVFVDAVAFLTGKRLSLPLDRYILVDIDDIFVGKEGTRMKVEDVKALFDTQNELRTHIPNFTFNLGYSGKFFHTGTDAEDAGDDLLLSYVKEFWWFPHMWSHMQPHLFHNQSVLAEQMALNKKFAVEHGIPTDMGYAVAPHHSGVYPVHVQLYEAWKQVWGIRVTSTEEYPHLKPARYRRGFIHNGIMVLPRQTCGLFTHTIFYNEYPGGSSELDKIINGGELFLTVLLNPISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNLRLQTLPPVQLAQKYFQIFSEEKDPLWQDPCEDKRHKDIWSKEKTCDRFPKLLIIGPQKTGTTALYLFLGMHPDLSSNYPSSETFEEIQFFNGHNYHKGIDWYMEFFPIPSNTTSDFYFEKSANYFDSEVAPRRAAALLPKAKILSILINPADRAYSWYQHQRAHDDPVALKYTFHEVITAGPDASSKLRALQNRCLVPGWYATHIERWLSAFHANQILVLDGKLLRTEPAKVMDTVQKFLGVTSTVDYHKTLAFDPKKGFWCQLLEGGKTKCLGKSKGRKYPEMDLDSRAFLKDYFRDHNIELSKLLYKMGQTLPTWLREDLQNTR" ;
	affx:hasCds [affx:startsAt "60983241" ;
			affx:stopsAt "61007485" ];
	affx:hasExon [ affx:relatesToExon :Ndst1_e1;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e6;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e7;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e8;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e9;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e10;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e11;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e12;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e13;
		affx:cdsType "Partial" ;
		affx:cdsStop "61001869" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Ndst1_e14;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "35" ;
				affx:spannedBy [ affx:startsAt "61007380" ;
					affx:stopsAt "61007485" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	.

:Ndst1_e1 a affx:Exon ; 
	affx:startsAt "60983241" ; 
	affx:stopsAt "60983361" ; 
	affx:commonToAll "1" .

:Ndst1_e2 a affx:Exon ; 
	affx:startsAt "60983960" ; 
	affx:stopsAt "60984063" ; 
	affx:commonToAll "1" .

:Ndst1_e3 a affx:Exon ; 
	affx:startsAt "60985174" ; 
	affx:stopsAt "60985284" ; 
	affx:commonToAll "1" .

:Ndst1_e4 a affx:Exon ; 
	affx:startsAt "60985925" ; 
	affx:stopsAt "60986096" ; 
	affx:commonToAll "1" .

:Ndst1_e5 a affx:Exon ; 
	affx:startsAt "60989450" ; 
	affx:stopsAt "60989625" ; 
	affx:commonToAll "1" .

:Ndst1_e6 a affx:Exon ; 
	affx:startsAt "60991181" ; 
	affx:stopsAt "60991305" ; 
	affx:commonToAll "1" .

:Ndst1_e7 a affx:Exon ; 
	affx:startsAt "60992553" ; 
	affx:stopsAt "60992650" ; 
	affx:commonToAll "1" .

:Ndst1_e8 a affx:Exon ; 
	affx:startsAt "60993622" ; 
	affx:stopsAt "60993805" ; 
	affx:commonToAll "1" .

:Ndst1_e9 a affx:Exon ; 
	affx:startsAt "60994489" ; 
	affx:stopsAt "60994618" ; 
	affx:commonToAll "1" .

:Ndst1_e10 a affx:Exon ; 
	affx:startsAt "60997020" ; 
	affx:stopsAt "60997206" ; 
	affx:commonToAll "1" .

:Ndst1_e11 a affx:Exon ; 
	affx:startsAt "60997984" ; 
	affx:stopsAt "60998139" ; 
	affx:commonToAll "1" .

:Ndst1_e12 a affx:Exon ; 
	affx:startsAt "60999323" ; 
	affx:stopsAt "60999411" ; 
	affx:commonToAll "1" .

:Ndst1_e13 a affx:Exon ; 
	affx:startsAt "61001849" ; 
	affx:stopsAt "61002345" ; 
	affx:commonToAll "1" .

:Ndst1_e14 a affx:Exon ; 
	affx:startsAt "61006972" ; 
	affx:stopsAt "61007485" ; 
	affx:commonToAll "1" .

:Nfatcb a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi2952323] .

:gi2952323 a affx:Transcript ;
	affx:unigene "iMm.10085" ;
	affx:translatesTo "MTGLEQDPEFDFDFLFEFDQSGGGAAAAEHYSYVSPSVTSTLPLPTAHSALPAACHDLQTSTPGISAVPSANHPPSYGGAVDSGPSGYFLSSGNTRPNGAPTLESPRIEITSYLGLHHGSGQFFHDVEVEDVLPSCKRSPSTATLHLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRSLGACHLLGSPRHSPSTSPRASITEESWLGARGSRPTSPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTEDTWLGNTTQYTSSAIVAAINALTTDSTLDLGDGVPIKSRKTALEHAPSVALKVEPAGEDLGTTPPTSDFPPEEYTFQHLRKGAFCEQYLSVPQASYQWAKPKSLSPTSYMSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEIILSNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVIGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVQVSFYVCNGKRKRSQYQRFTYLPANGNSVFLTLSSESELRGGFY" ;
	affx:hasCds [affx:startsAt "81227912" ;
			affx:stopsAt "81286009" ];
	affx:hasExon [ affx:relatesToExon :Nfatcb_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "81227912" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Nfatcb_e2;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Nfatcb_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Nfatcb_e4;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Nfatcb_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Nfatcb_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Nfatcb_e7;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Nfatcb_e8;
		affx:cdsType "Partial" ;
		affx:cdsStop "81286009" ;
		affx:frame "0"] ;
	.

:Nfatcb_e1 a affx:Exon ; 
	affx:startsAt "81226598" ; 
	affx:stopsAt "81228104" ; 
	affx:commonToAll "1" .

:Nfatcb_e2 a affx:Exon ; 
	affx:startsAt "81231736" ; 
	affx:stopsAt "81231792" ; 
	affx:commonToAll "1" .

:Nfatcb_e3 a affx:Exon ; 
	affx:startsAt "81241525" ; 
	affx:stopsAt "81241666" ; 
	affx:commonToAll "1" .

:Nfatcb_e4 a affx:Exon ; 
	affx:startsAt "81243512" ; 
	affx:stopsAt "81243685" ; 
	affx:commonToAll "1" .

:Nfatcb_e5 a affx:Exon ; 
	affx:startsAt "81245188" ; 
	affx:stopsAt "81245391" ; 
	affx:commonToAll "1" .

:Nfatcb_e6 a affx:Exon ; 
	affx:startsAt "81260389" ; 
	affx:stopsAt "81260549" ; 
	affx:commonToAll "1" .

:Nfatcb_e7 a affx:Exon ; 
	affx:startsAt "81275656" ; 
	affx:stopsAt "81276758" ; 
	affx:commonToAll "1" .

:Nfatcb_e8 a affx:Exon ; 
	affx:startsAt "81285924" ; 
	affx:stopsAt "81286015" ; 
	affx:commonToAll "1" .

:Phax-pending a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi9910489] .

:gi9910489 a affx:Transcript ;
	affx:unigene "iMm.214569" ;
	affx:translatesTo "MALEAGDMEEGQLSDSDSDMTVVPSDRPLQMAKVLGGGSAACAPVSHYRTVKHVDSSEESLDSDDDCSLWKRKRQKCHNTPPKPEPFPFGPSGQKTALNGGKKVNNIWGAVLQEQNQDAVATELGILGMEGSIDRSRQSETYNYLLAKKLAKKESQEYTKELDKDLDEYMHGDKKPGSKEDENGQGHLKRKRPVRDRLGNRVEMNYKGRYEITEEDAPEKVADEIAFRLQEPKKDLIARVVRILGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYVENQKEYENKKAARKRRTQLLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDEAQEGPGETKLDAEEAIEVDHPQDLDIF" ;
	affx:hasCds [affx:startsAt "56854117" ;
			affx:stopsAt "56868224" ];
	affx:hasExon [ affx:relatesToExon :Phax-pending_e1;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Phax-pending_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Phax-pending_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Phax-pending_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Phax-pending_e5;
		affx:cdsType "Partial" ;
		affx:cdsStop "56868224" ;
		affx:frame "1"] ;
	.

:Phax-pending_e1 a affx:Exon ; 
	affx:startsAt "56854117" ; 
	affx:stopsAt "56854213" ; 
	affx:commonToAll "1" .

:Phax-pending_e2 a affx:Exon ; 
	affx:startsAt "56856539" ; 
	affx:stopsAt "56857126" ; 
	affx:commonToAll "1" .

:Phax-pending_e3 a affx:Exon ; 
	affx:startsAt "56861257" ; 
	affx:stopsAt "56861378" ; 
	affx:commonToAll "1" .

:Phax-pending_e4 a affx:Exon ; 
	affx:startsAt "56865368" ; 
	affx:stopsAt "56865452" ; 
	affx:commonToAll "1" .

:Phax-pending_e5 a affx:Exon ; 
	affx:startsAt "56867954" ; 
	affx:stopsAt "56868251" ; 
	affx:commonToAll "1" .

:Ndufa2 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi4836510] .

:gi4836510 a affx:Transcript ;
	affx:unigene "iMm.29867" ;
	affx:translatesTo "MAAAAASRAVGAKLGLREIRVHLCQRSPGSQGVRDFIVQRYVELKKAHPNLPILIRECSEVQPKLWARYAFGQEKTVSLNNLSADEVTRAMQNVLSGKA" ;
	affx:hasCds [affx:startsAt "36929836" ;
			affx:stopsAt "36931790" ];
	affx:hasExon [ affx:relatesToExon :Ndufa2_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "36929836" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Ndufa2_e2;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Ndufa2_e3;
		affx:cdsType "Partial" ;
		affx:cdsStop "36931790" ;
		affx:frame "1"] ;
	.

:Ndufa2_e1 a affx:Exon ; 
	affx:startsAt "36929730" ; 
	affx:stopsAt "36929928" ; 
	affx:commonToAll "1" .

:Ndufa2_e2 a affx:Exon ; 
	affx:startsAt "36931450" ; 
	affx:stopsAt "36931557" ; 
	affx:commonToAll "1" .

:Ndufa2_e3 a affx:Exon ; 
	affx:startsAt "36931689" ; 
	affx:stopsAt "36931809" ; 
	affx:commonToAll "1" .

:Gene2999 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi500623] .

:gi500623 a affx:Transcript ;
	affx:unigene "iMm.172" ;
	affx:translatesTo "MRFAWAVLLLGPLQLCPLLRCAPQTPREPPAAPGAWRQTIQWENNGQVFSLLSLGAQYQPQRRRDPSATARRPDGDAASQPRTPILLLRDNRTASTRARTPSPSGVAAGRPRPAARHWFQAGFSPSGARDGASRRAANRTASPQPPQLSNLRPPSHIDRMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY" ;
	affx:hasCds [affx:startsAt "52780870" ;
			affx:stopsAt "52800741" ];
	affx:hasExon [ affx:relatesToExon :Gene2999_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "52780870" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene2999_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene2999_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene2999_e4;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene2999_e5;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene2999_e6;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene2999_e7;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene2999_e8;
		affx:cdsType "Partial" ;
		affx:cdsStop "52800741" ;
		affx:frame "0"] ;
	.

:Gene2999_e1 a affx:Exon ; 
	affx:startsAt "52777710" ; 
	affx:stopsAt "52780877" ; 
	affx:commonToAll "1" .

:Gene2999_e2 a affx:Exon ; 
	affx:startsAt "52782437" ; 
	affx:stopsAt "52782471" ; 
	affx:commonToAll "1" .

:Gene2999_e3 a affx:Exon ; 
	affx:startsAt "52782587" ; 
	affx:stopsAt "52782669" ; 
	affx:commonToAll "1" .

:Gene2999_e4 a affx:Exon ; 
	affx:startsAt "52783002" ; 
	affx:stopsAt "52783098" ; 
	affx:commonToAll "1" .

:Gene2999_e5 a affx:Exon ; 
	affx:startsAt "52796494" ; 
	affx:stopsAt "52796651" ; 
	affx:commonToAll "1" .

:Gene2999_e6 a affx:Exon ; 
	affx:startsAt "52798312" ; 
	affx:stopsAt "52798450" ; 
	affx:commonToAll "1" .

:Gene2999_e7 a affx:Exon ; 
	affx:startsAt "52799690" ; 
	affx:stopsAt "52799799" ; 
	affx:commonToAll "1" .

:Gene2999_e8 a affx:Exon ; 
	affx:startsAt "52800128" ; 
	affx:stopsAt "52801003" ; 
	affx:commonToAll "1" .

:Gene3000 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18044166] .

:gi18044166 a affx:Transcript ;
	affx:unigene "iMm.31695" ;
	affx:translatesTo "MDRHSSYFFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDERQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGQENCCLTCDKMRQAELSNEKILSLVHWGMYSGHGKLEFI" ;
	affx:hasCds [affx:startsAt "3363184" ;
			affx:stopsAt "3367375" ];
	affx:hasExon [ affx:relatesToExon :Gene3000_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "3363184" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3000_e2;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3000_e3;
		affx:cdsType "Partial" ;
		affx:cdsStop "3367375" ;
		affx:frame "1"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "26" ;
				affx:spannedBy [ affx:startsAt "3363184" ;
					affx:stopsAt "3363260" ;
					affx:inFrame "0" ] ;
				affx:spannedBy [ affx:startsAt "3366231" ;
					affx:stopsAt "3366233" ;
					affx:inFrame "0" ] ;
			] ;
		] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "149" ;
				affx:stopsAt "171" ;
				affx:spannedBy [ affx:startsAt "3367039" ;
					affx:stopsAt "3367105" ;
					affx:inFrame "1" ] ;
			] ;
		] ;
	.

:Gene3000_e1 a affx:Exon ; 
	affx:startsAt "3362949" ; 
	affx:stopsAt "3363260" ; 
	affx:commonToAll "1" .

:Gene3000_e2 a affx:Exon ; 
	affx:startsAt "3366231" ; 
	affx:stopsAt "3366519" ; 
	affx:commonToAll "1" .

:Gene3000_e3 a affx:Exon ; 
	affx:startsAt "3366956" ; 
	affx:stopsAt "3367732" ; 
	affx:commonToAll "1" .

:Gata6 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi5882287] .

:gi5882287 a affx:Transcript ;
	affx:unigene "iMm.202639" ;
	affx:translatesTo "MYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLSGLPYLQGAGSGPSNHAGGAGAHPGWSQASADSPPYGGGGAAGGGAAGPGGAGSATAHASARFPYSPSPPMANGAARDPGGYVAAGGTGAGSVSGGGGSLAAMGGREHQYSSLSAARPLNGTYHHHHHHHPTYSPYMAAPLTPAWPAGPFETPVLHSLQGRAGAPLPVPRGPSTDLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNINKSKACSGNSSGSVPMTPTSSSSNSDDCTKNTSPSTQATTSGVGASVMSAVGENANPENSDLKYSGQDGLYIGVSLSSPAEVTSSVRQDSWCALALA" ;
	affx:hasCds [affx:startsAt "10923433" ;
			affx:stopsAt "10953535" ];
	affx:hasExon [ affx:relatesToExon :Gata6_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "10923433" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gata6_e2;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gata6_e3;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gata6_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gata6_e5;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gata6_e6;
		affx:cdsType "Partial" ;
		affx:cdsStop "10953535" ;
		affx:frame "2"] ;
	.

:Gata6_e1 a affx:Exon ; 
	affx:startsAt "10923417" ; 
	affx:stopsAt "10924112" ; 
	affx:commonToAll "1" .

:Gata6_e2 a affx:Exon ; 
	affx:startsAt "10927975" ; 
	affx:stopsAt "10928142" ; 
	affx:commonToAll "1" .

:Gata6_e3 a affx:Exon ; 
	affx:startsAt "10932157" ; 
	affx:stopsAt "10932283" ; 
	affx:commonToAll "1" .

:Gata6_e4 a affx:Exon ; 
	affx:startsAt "10933649" ; 
	affx:stopsAt "10933737" ; 
	affx:commonToAll "1" .

:Gata6_e5 a affx:Exon ; 
	affx:startsAt "10933827" ; 
	affx:stopsAt "10933931" ; 
	affx:commonToAll "1" .

:Gata6_e6 a affx:Exon ; 
	affx:startsAt "10953367" ; 
	affx:stopsAt "10953549" ; 
	affx:commonToAll "1" .

:Gene3002 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi11093908] .

:gi11093908 a affx:Transcript ;
	affx:unigene "iMm.9212" ;
	affx:translatesTo "MRPAALLLCLTLLHCAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGLGDCHNSFVALNGHASSLYPSTTTSDSASRDGYESRGGMLDWNDLLEAPGSTDPLGAVSSHNHQDKKGVIRESYLKSNDQLVPVTLLAIAVILAFVMGAVFSGIIVYCVCDHRRKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPEAILTPLMHNGKLATPSNTAKMLIKADQHHLDLTALPTPESTPTLQQKRKPNRGSREWERNQNIINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEVVAQMALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQREASLGPPGTSLSQTGLSKRLEMQHSSSYGLEYKRSYPTNSLTRSHQTTTLKRNNTNSSNSSHLSRNQSFGRGDNPPPAPQRVDSIQVHSSQPSGQAVTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKPSFAPLSTSMKPNDACT" ;
	affx:hasCds [affx:startsAt "47432245" ;
			affx:stopsAt "47490635" ];
	affx:hasExon [ affx:relatesToExon :Gene3002_e1;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e3;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e5;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e7;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e8;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e9;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e10;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e11;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e12;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e13;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e14;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e15;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e16;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e17;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e18;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3002_e19;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "18" ;
				affx:spannedBy [ affx:startsAt "47490581" ;
					affx:stopsAt "47490635" ;
					affx:inFrame "0" ] ;
			] ;
		] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "622" ;
				affx:stopsAt "644" ;
				affx:spannedBy [ affx:startsAt "47433331" ;
					affx:stopsAt "47433397" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	.

:Gene3002_e1 a affx:Exon ; 
	affx:startsAt "47432245" ; 
	affx:stopsAt "47433447" ; 
	affx:commonToAll "1" .

:Gene3002_e2 a affx:Exon ; 
	affx:startsAt "47454748" ; 
	affx:stopsAt "47454913" ; 
	affx:commonToAll "1" .

:Gene3002_e3 a affx:Exon ; 
	affx:startsAt "47460759" ; 
	affx:stopsAt "47460780" ; 
	affx:commonToAll "1" .

:Gene3002_e4 a affx:Exon ; 
	affx:startsAt "47463289" ; 
	affx:stopsAt "47463348" ; 
	affx:commonToAll "1" .

:Gene3002_e5 a affx:Exon ; 
	affx:startsAt "47465293" ; 
	affx:stopsAt "47465374" ; 
	affx:commonToAll "1" .

:Gene3002_e6 a affx:Exon ; 
	affx:startsAt "47465465" ; 
	affx:stopsAt "47465606" ; 
	affx:commonToAll "1" .

:Gene3002_e7 a affx:Exon ; 
	affx:startsAt "47465968" ; 
	affx:stopsAt "47466000" ; 
	affx:commonToAll "1" .

:Gene3002_e8 a affx:Exon ; 
	affx:startsAt "47466078" ; 
	affx:stopsAt "47466145" ; 
	affx:commonToAll "1" .

:Gene3002_e9 a affx:Exon ; 
	affx:startsAt "47467482" ; 
	affx:stopsAt "47467638" ; 
	affx:commonToAll "1" .

:Gene3002_e10 a affx:Exon ; 
	affx:startsAt "47471601" ; 
	affx:stopsAt "47471733" ; 
	affx:commonToAll "1" .

:Gene3002_e11 a affx:Exon ; 
	affx:startsAt "47474155" ; 
	affx:stopsAt "47474373" ; 
	affx:commonToAll "1" .

:Gene3002_e12 a affx:Exon ; 
	affx:startsAt "47475275" ; 
	affx:stopsAt "47475364" ; 
	affx:commonToAll "1" .

:Gene3002_e13 a affx:Exon ; 
	affx:startsAt "47476067" ; 
	affx:stopsAt "47476187" ; 
	affx:commonToAll "1" .

:Gene3002_e14 a affx:Exon ; 
	affx:startsAt "47478199" ; 
	affx:stopsAt "47478290" ; 
	affx:commonToAll "1" .

:Gene3002_e15 a affx:Exon ; 
	affx:startsAt "47482365" ; 
	affx:stopsAt "47482467" ; 
	affx:commonToAll "1" .

:Gene3002_e16 a affx:Exon ; 
	affx:startsAt "47483256" ; 
	affx:stopsAt "47483319" ; 
	affx:commonToAll "1" .

:Gene3002_e17 a affx:Exon ; 
	affx:startsAt "47484263" ; 
	affx:stopsAt "47484324" ; 
	affx:commonToAll "1" .

:Gene3002_e18 a affx:Exon ; 
	affx:startsAt "47488283" ; 
	affx:stopsAt "47488401" ; 
	affx:commonToAll "1" .

:Gene3002_e19 a affx:Exon ; 
	affx:startsAt "47490535" ; 
	affx:stopsAt "47490635" ; 
	affx:commonToAll "1" .

:Gene3003 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi13278060] .

:gi13278060 a affx:Transcript ;
	affx:unigene "iMm.12193" ;
	affx:translatesTo "MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPVKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEEAS" ;
	affx:hasCds [affx:startsAt "14582254" ;
			affx:stopsAt "14582746" ];
	affx:hasExon [ affx:relatesToExon :Gene3003_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "14582254" ;
		affx:cdsStop "14582746" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3003_e2;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3003_e3;
		affx:cdsType "None" ] ;
	.

:Gene3003_e1 a affx:Exon ; 
	affx:startsAt "14582220" ; 
	affx:stopsAt "14583459" ; 
	affx:commonToAll "1" .

:Gene3003_e2 a affx:Exon ; 
	affx:startsAt "14583483" ; 
	affx:stopsAt "14583497" ; 
	affx:commonToAll "1" .

:Gene3003_e3 a affx:Exon ; 
	affx:startsAt "14583519" ; 
	affx:stopsAt "14583825" ; 
	affx:commonToAll "1" .

:Gene3004 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi13435683] .

:gi13435683 a affx:Transcript ;
	affx:unigene "iMm.36817" ;
	affx:translatesTo "MFSRLRAVTTPCTLTCRRVHLKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACCQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIQPEKCLPVCIDVGTDNMALLKDPFYMGLYQKRDRSQLYDDLMDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYQQKYCTFNDDIQGTAAVALSGLLAAQRVINKPVSEHKILFLGAGEAALGIANLIVLSMVESGLSEEEAQRKIWMFDKSGLLVKGRTASIDSNQEPYAHAAPESIPATFEDAVNKLKPSVIIGVAGAGPLFTHGVIKAMASINERPIIFALSNPTAQAECTAEDAYTLTEGRCLFASGSPFEPVKLQDGRVFTPGQGNNAYIFPGVALAVILCEARHISDTVFLEAAKALTTQLTDAELAQGRLYPSLANIQEVSANIAIKLAEYLYANKMAFRYPEPEDKARYVRERIWRSNYVSLLPDVYDWPESSLTPPQITEEKLPH" ;
	affx:hasCds [affx:startsAt "74143672" ;
			affx:stopsAt "74178208" ];
	affx:hasExon [ affx:relatesToExon :Gene3004_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "74143672" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e3;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e4;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e7;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e8;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e9;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e10;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e11;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e12;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e13;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e14;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e15;
		affx:cdsType "Partial" ;
		affx:cdsStop "74178208" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3004_e16;
		affx:cdsType "None" ] ;
	.

:Gene3004_e1 a affx:Exon ; 
	affx:startsAt "74143085" ; 
	affx:stopsAt "74143855" ; 
	affx:commonToAll "1" .

:Gene3004_e2 a affx:Exon ; 
	affx:startsAt "74146176" ; 
	affx:stopsAt "74146275" ; 
	affx:commonToAll "1" .

:Gene3004_e3 a affx:Exon ; 
	affx:startsAt "74148425" ; 
	affx:stopsAt "74148496" ; 
	affx:commonToAll "1" .

:Gene3004_e4 a affx:Exon ; 
	affx:startsAt "74154090" ; 
	affx:stopsAt "74154193" ; 
	affx:commonToAll "1" .

:Gene3004_e5 a affx:Exon ; 
	affx:startsAt "74158743" ; 
	affx:stopsAt "74158886" ; 
	affx:commonToAll "1" .

:Gene3004_e6 a affx:Exon ; 
	affx:startsAt "74161402" ; 
	affx:stopsAt "74161517" ; 
	affx:commonToAll "1" .

:Gene3004_e7 a affx:Exon ; 
	affx:startsAt "74164132" ; 
	affx:stopsAt "74164246" ; 
	affx:commonToAll "1" .

:Gene3004_e8 a affx:Exon ; 
	affx:startsAt "74164657" ; 
	affx:stopsAt "74164755" ; 
	affx:commonToAll "1" .

:Gene3004_e9 a affx:Exon ; 
	affx:startsAt "74164849" ; 
	affx:stopsAt "74164959" ; 
	affx:commonToAll "1" .

:Gene3004_e10 a affx:Exon ; 
	affx:startsAt "74167494" ; 
	affx:stopsAt "74167598" ; 
	affx:commonToAll "1" .

:Gene3004_e11 a affx:Exon ; 
	affx:startsAt "74167829" ; 
	affx:stopsAt "74167991" ; 
	affx:commonToAll "1" .

:Gene3004_e12 a affx:Exon ; 
	affx:startsAt "74169362" ; 
	affx:stopsAt "74169438" ; 
	affx:commonToAll "1" .

:Gene3004_e13 a affx:Exon ; 
	affx:startsAt "74170877" ; 
	affx:stopsAt "74171027" ; 
	affx:commonToAll "1" .

:Gene3004_e14 a affx:Exon ; 
	affx:startsAt "74174777" ; 
	affx:stopsAt "74174911" ; 
	affx:commonToAll "1" .

:Gene3004_e15 a affx:Exon ; 
	affx:startsAt "74178100" ; 
	affx:stopsAt "74178218" ; 
	affx:commonToAll "1" .

:Gene3004_e16 a affx:Exon ; 
	affx:startsAt "74188297" ; 
	affx:stopsAt "74188386" ; 
	affx:commonToAll "1" .

:Gene3005 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi13435941] .

:gi13435941 a affx:Transcript ;
	affx:unigene "iMm.174478" ;
	affx:translatesTo "MLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY" ;
	affx:hasCds [affx:startsAt "31966066" ;
			affx:stopsAt "31970316" ];
	affx:hasExon [ affx:relatesToExon :Gene3005_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3005_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "31966066" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3005_e3;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3005_e4;
		affx:cdsType "Partial" ;
		affx:cdsStop "31970316" ;
		affx:frame "0"] ;
	.

:Gene3005_e1 a affx:Exon ; 
	affx:startsAt "31963274" ; 
	affx:stopsAt "31963343" ; 
	affx:commonToAll "1" .

:Gene3005_e2 a affx:Exon ; 
	affx:startsAt "31966025" ; 
	affx:stopsAt "31966206" ; 
	affx:commonToAll "1" .

:Gene3005_e3 a affx:Exon ; 
	affx:startsAt "31969475" ; 
	affx:stopsAt "31969571" ; 
	affx:commonToAll "1" .

:Gene3005_e4 a affx:Exon ; 
	affx:startsAt "31970237" ; 
	affx:stopsAt "31970894" ; 
	affx:commonToAll "1" .

:Gene3006 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi15214564] .

:gi15214564 a affx:Transcript ;
	affx:unigene "iMm.30250" ;
	affx:translatesTo "MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKEVALMVQERFGKSLLELGGNNAIIAFEDADLSLVVPSVLFAAVGTAGQRCTTVRRLFLHESIHNEVVDRLRSAYSQIRVGNPWDPNILYGPLHTKQAVSMFVRAVEEAKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHDAPIVHQETFAPILYVFKFQDEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ" ;
	affx:hasCds [affx:startsAt "56808348" ;
			affx:stopsAt "56843617" ];
	affx:hasExon [ affx:relatesToExon :Gene3006_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "56808348" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e2;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e4;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e6;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e7;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e8;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e9;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e10;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e11;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e12;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e13;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e14;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e15;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e16;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e17;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3006_e18;
		affx:cdsType "Partial" ;
		affx:cdsStop "56843617" ;
		affx:frame "2"] ;
	.

:Gene3006_e1 a affx:Exon ; 
	affx:startsAt "56808139" ; 
	affx:stopsAt "56808403" ; 
	affx:commonToAll "1" .

:Gene3006_e2 a affx:Exon ; 
	affx:startsAt "56809672" ; 
	affx:stopsAt "56809748" ; 
	affx:commonToAll "1" .

:Gene3006_e3 a affx:Exon ; 
	affx:startsAt "56812888" ; 
	affx:stopsAt "56812962" ; 
	affx:commonToAll "1" .

:Gene3006_e4 a affx:Exon ; 
	affx:startsAt "56813109" ; 
	affx:stopsAt "56813207" ; 
	affx:commonToAll "1" .

:Gene3006_e5 a affx:Exon ; 
	affx:startsAt "56813379" ; 
	affx:stopsAt "56813496" ; 
	affx:commonToAll "1" .

:Gene3006_e6 a affx:Exon ; 
	affx:startsAt "56813886" ; 
	affx:stopsAt "56813993" ; 
	affx:commonToAll "1" .

:Gene3006_e7 a affx:Exon ; 
	affx:startsAt "56815588" ; 
	affx:stopsAt "56815673" ; 
	affx:commonToAll "1" .

:Gene3006_e8 a affx:Exon ; 
	affx:startsAt "56818602" ; 
	affx:stopsAt "56818697" ; 
	affx:commonToAll "1" .

:Gene3006_e9 a affx:Exon ; 
	affx:startsAt "56820177" ; 
	affx:stopsAt "56820219" ; 
	affx:commonToAll "1" .

:Gene3006_e10 a affx:Exon ; 
	affx:startsAt "56823701" ; 
	affx:stopsAt "56823799" ; 
	affx:commonToAll "1" .

:Gene3006_e11 a affx:Exon ; 
	affx:startsAt "56826441" ; 
	affx:stopsAt "56826519" ; 
	affx:commonToAll "1" .

:Gene3006_e12 a affx:Exon ; 
	affx:startsAt "56828380" ; 
	affx:stopsAt "56828425" ; 
	affx:commonToAll "1" .

:Gene3006_e13 a affx:Exon ; 
	affx:startsAt "56829923" ; 
	affx:stopsAt "56830056" ; 
	affx:commonToAll "1" .

:Gene3006_e14 a affx:Exon ; 
	affx:startsAt "56831772" ; 
	affx:stopsAt "56831896" ; 
	affx:commonToAll "1" .

:Gene3006_e15 a affx:Exon ; 
	affx:startsAt "56832636" ; 
	affx:stopsAt "56832717" ; 
	affx:commonToAll "1" .

:Gene3006_e16 a affx:Exon ; 
	affx:startsAt "56840698" ; 
	affx:stopsAt "56840764" ; 
	affx:commonToAll "1" .

:Gene3006_e17 a affx:Exon ; 
	affx:startsAt "56842252" ; 
	affx:stopsAt "56842306" ; 
	affx:commonToAll "1" .

:Gene3006_e18 a affx:Exon ; 
	affx:startsAt "56843509" ; 
	affx:stopsAt "56843737" ; 
	affx:commonToAll "1" .

:Gene3007 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi15030078] .

:gi15030078 a affx:Transcript ;
	affx:unigene "iMm.207083" ;
	affx:translatesTo "MRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPFITCCGGKSSEDPSDEISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY" ;
	affx:hasCds [affx:startsAt "10660806" ;
			affx:stopsAt "10679898" ];
	affx:hasExon [ affx:relatesToExon :Gene3007_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3007_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "10660806" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3007_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3007_e4;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3007_e5;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3007_e6;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3007_e7;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3007_e8;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3007_e9;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3007_e10;
		affx:cdsType "Partial" ;
		affx:cdsStop "10679898" ;
		affx:frame "2"] ;
	.

:Gene3007_e1 a affx:Exon ; 
	affx:startsAt "10646102" ; 
	affx:stopsAt "10646208" ; 
	affx:commonToAll "1" .

:Gene3007_e2 a affx:Exon ; 
	affx:startsAt "10660802" ; 
	affx:stopsAt "10660935" ; 
	affx:commonToAll "1" .

:Gene3007_e3 a affx:Exon ; 
	affx:startsAt "10662385" ; 
	affx:stopsAt "10662472" ; 
	affx:commonToAll "1" .

:Gene3007_e4 a affx:Exon ; 
	affx:startsAt "10663597" ; 
	affx:stopsAt "10663759" ; 
	affx:commonToAll "1" .

:Gene3007_e5 a affx:Exon ; 
	affx:startsAt "10666259" ; 
	affx:stopsAt "10666441" ; 
	affx:commonToAll "1" .

:Gene3007_e6 a affx:Exon ; 
	affx:startsAt "10667963" ; 
	affx:stopsAt "10668156" ; 
	affx:commonToAll "1" .

:Gene3007_e7 a affx:Exon ; 
	affx:startsAt "10670168" ; 
	affx:stopsAt "10670247" ; 
	affx:commonToAll "1" .

:Gene3007_e8 a affx:Exon ; 
	affx:startsAt "10672594" ; 
	affx:stopsAt "10672708" ; 
	affx:commonToAll "1" .

:Gene3007_e9 a affx:Exon ; 
	affx:startsAt "10675806" ; 
	affx:stopsAt "10675907" ; 
	affx:commonToAll "1" .

:Gene3007_e10 a affx:Exon ; 
	affx:startsAt "10679757" ; 
	affx:stopsAt "10679983" ; 
	affx:commonToAll "1" .

:Gene3008 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18043556] .

:gi18043556 a affx:Transcript ;
	affx:unigene "iMm.32512" ;
	affx:translatesTo "MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREARFIHNIPFSVVPIVMVKLLSKCILGAKMHGLSQILGNFLHLMNTIFLFVFTHSPFCWHLSEVVLSWYQPLQYVRDVLSATFCTGFLFHLWLIMCIRYSFLLSTV" ;
	affx:hasCds [affx:startsAt "32001911" ;
			affx:stopsAt "32008673" ];
	affx:hasExon [ affx:relatesToExon :Gene3008_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3008_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "32001911" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3008_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3008_e4;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3008_e5;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3008_e6;
		affx:cdsType "Partial" ;
		affx:cdsStop "32008673" ;
		affx:frame "1"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "2" ;
		affx:containsMotif [ affx:startsAt "243" ;
				affx:stopsAt "265" ;
				affx:spannedBy [ affx:startsAt "32008463" ;
					affx:stopsAt "32008529" ;
					affx:inFrame "1" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "285" ;
				affx:stopsAt "307" ;
				affx:spannedBy [ affx:startsAt "32008589" ;
					affx:stopsAt "32008655" ;
					affx:inFrame "1" ] ;
			] ;
		] ;
	.

:Gene3008_e1 a affx:Exon ; 
	affx:startsAt "31978244" ; 
	affx:stopsAt "31978442" ; 
	affx:commonToAll "1" .

:Gene3008_e2 a affx:Exon ; 
	affx:startsAt "32001888" ; 
	affx:stopsAt "32002115" ; 
	affx:commonToAll "1" .

:Gene3008_e3 a affx:Exon ; 
	affx:startsAt "32003858" ; 
	affx:stopsAt "32003927" ; 
	affx:commonToAll "1" .

:Gene3008_e4 a affx:Exon ; 
	affx:startsAt "32004501" ; 
	affx:stopsAt "32004606" ; 
	affx:commonToAll "1" .

:Gene3008_e5 a affx:Exon ; 
	affx:startsAt "32007935" ; 
	affx:stopsAt "32008031" ; 
	affx:commonToAll "1" .

:Gene3008_e6 a affx:Exon ; 
	affx:startsAt "32008208" ; 
	affx:stopsAt "32008714" ; 
	affx:commonToAll "1" .

:Gene3009 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi15079292] .

:gi15079292 a affx:Transcript ;
	affx:unigene "iMm.5972" ;
	affx:translatesTo "MKYGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCIVPVTENLLCTGSTDGIIRAVNILPNRVVGTVGQHAGEPVEALALSHCGHFLASSGHDQRLKFWDMTQLRTVVVDDYRRRKKKGGPLRALSSKAWSTDDFFAGLREDEEDAKAPEEVVRESDDDDDDSD" ;
	affx:hasCds [affx:startsAt "36950024" ;
			affx:stopsAt "36950698" ];
	affx:hasExon [ affx:relatesToExon :Gene3009_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3009_e2;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3009_e3;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3009_e4;
		affx:cdsType "Partial" ;
		affx:cdsStart "36950024" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3009_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3009_e6;
		affx:cdsType "Partial" ;
		affx:cdsStop "36950698" ;
		affx:frame "0"] ;
	.

:Gene3009_e1 a affx:Exon ; 
	affx:startsAt "36949340" ; 
	affx:stopsAt "36949350" ; 
	affx:commonToAll "1" .

:Gene3009_e2 a affx:Exon ; 
	affx:startsAt "36949438" ; 
	affx:stopsAt "36949526" ; 
	affx:commonToAll "1" .

:Gene3009_e3 a affx:Exon ; 
	affx:startsAt "36949627" ; 
	affx:stopsAt "36949807" ; 
	affx:commonToAll "1" .

:Gene3009_e4 a affx:Exon ; 
	affx:startsAt "36949930" ; 
	affx:stopsAt "36950030" ; 
	affx:commonToAll "1" .

:Gene3009_e5 a affx:Exon ; 
	affx:startsAt "36950121" ; 
	affx:stopsAt "36950291" ; 
	affx:commonToAll "1" .

:Gene3009_e6 a affx:Exon ; 
	affx:startsAt "36950364" ; 
	affx:stopsAt "36951083" ; 
	affx:commonToAll "1" .

:Gene3010 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi14198314] .

:gi14198314 a affx:Transcript ;
	affx:unigene "iMm.21177" ;
	affx:translatesTo "MKGIKSEEVKINNIAIEINKATKRDPGNCNLDNHIKPSPDSSLDNQMKLSCESAPDQNFSICSASEVETNPLENTAAASTLLSQAKIDEDRTFPGSAPNQQHSVLSDEASINRKNRDVPPNHSQLKHDSHLEITIPKSLKLKDSEKVDEKQLVIDAGHKRFGAVSCNICGMLYTASNPEDETQHLLFHNQFISAVKYVVLLINHHECGSEEEFITSLFLSMSNFRYTQRSLLPY" ;
	affx:hasCds [affx:startsAt "10445580" ;
			affx:stopsAt "10461848" ];
	affx:hasExon [ affx:relatesToExon :Gene3010_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3010_e2;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3010_e3;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3010_e4;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3010_e5;
		affx:cdsType "Partial" ;
		affx:cdsStart "10445580" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3010_e6;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3010_e7;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3010_e8;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3010_e9;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3010_e10;
		affx:cdsType "Partial" ;
		affx:cdsStop "10461848" ;
		affx:frame "2"] ;
	.

:Gene3010_e1 a affx:Exon ; 
	affx:startsAt "10434533" ; 
	affx:stopsAt "10435578" ; 
	affx:commonToAll "1" .

:Gene3010_e2 a affx:Exon ; 
	affx:startsAt "10439886" ; 
	affx:stopsAt "10440074" ; 
	affx:commonToAll "1" .

:Gene3010_e3 a affx:Exon ; 
	affx:startsAt "10442806" ; 
	affx:stopsAt "10442950" ; 
	affx:commonToAll "1" .

:Gene3010_e4 a affx:Exon ; 
	affx:startsAt "10444932" ; 
	affx:stopsAt "10445022" ; 
	affx:commonToAll "1" .

:Gene3010_e5 a affx:Exon ; 
	affx:startsAt "10445569" ; 
	affx:stopsAt "10445691" ; 
	affx:commonToAll "1" .

:Gene3010_e6 a affx:Exon ; 
	affx:startsAt "10449986" ; 
	affx:stopsAt "10450118" ; 
	affx:commonToAll "1" .

:Gene3010_e7 a affx:Exon ; 
	affx:startsAt "10452179" ; 
	affx:stopsAt "10452294" ; 
	affx:commonToAll "1" .

:Gene3010_e8 a affx:Exon ; 
	affx:startsAt "10453909" ; 
	affx:stopsAt "10453973" ; 
	affx:commonToAll "1" .

:Gene3010_e9 a affx:Exon ; 
	affx:startsAt "10456370" ; 
	affx:stopsAt "10456482" ; 
	affx:commonToAll "1" .

:Gene3010_e10 a affx:Exon ; 
	affx:startsAt "10461677" ; 
	affx:stopsAt "10461987" ; 
	affx:commonToAll "1" .

:Gene3011 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi14198334] .

:gi14198334 a affx:Transcript ;
	affx:unigene "iMm.29247" ;
	affx:translatesTo "MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNIKRRSFADFDPHHFWHWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNYCHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMVDLVILGQAYAFAHHPQKPAAHAVHPASTKAL" ;
	affx:hasCds [affx:startsAt "80832994" ;
			affx:stopsAt "80868265" ];
	affx:hasExon [ affx:relatesToExon :Gene3011_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "80832994" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3011_e2;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3011_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3011_e4;
		affx:cdsType "Partial" ;
		affx:cdsStop "80868265" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3011_e5;
		affx:cdsType "None" ] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "22" ;
				affx:spannedBy [ affx:startsAt "80832994" ;
					affx:stopsAt "80833060" ;
					affx:inFrame "0" ] ;
			] ;
		] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "3" ;
		affx:containsMotif [ affx:startsAt "49" ;
				affx:stopsAt "68" ;
				affx:spannedBy [ affx:startsAt "80833141" ;
					affx:stopsAt "80833197" ;
					affx:inFrame "0" ] ;
				affx:spannedBy [ affx:startsAt "80839728" ;
					affx:stopsAt "80839729" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "78" ;
				affx:stopsAt "100" ;
				affx:spannedBy [ affx:startsAt "80839759" ;
					affx:stopsAt "80839825" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "131" ;
				affx:stopsAt "153" ;
				affx:spannedBy [ affx:startsAt "80859813" ;
					affx:stopsAt "80859879" ;
					affx:inFrame "1" ] ;
			] ;
		] ;
	.

:Gene3011_e1 a affx:Exon ; 
	affx:startsAt "80832859" ; 
	affx:stopsAt "80833197" ; 
	affx:commonToAll "1" .

:Gene3011_e2 a affx:Exon ; 
	affx:startsAt "80839728" ; 
	affx:stopsAt "80839862" ; 
	affx:commonToAll "1" .

:Gene3011_e3 a affx:Exon ; 
	affx:startsAt "80859757" ; 
	affx:stopsAt "80859974" ; 
	affx:commonToAll "1" .

:Gene3011_e4 a affx:Exon ; 
	affx:startsAt "80868057" ; 
	affx:stopsAt "80868301" ; 
	affx:commonToAll "1" .

:Gene3011_e5 a affx:Exon ; 
	affx:startsAt "80868401" ; 
	affx:stopsAt "80869269" ; 
	affx:commonToAll "1" .

:Gene3012 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi1144349] ;
	affx:hasVariant [affx:representedBy :gi1808953] ;
	affx:hasVariant [affx:representedBy :gi18481726] ;
	affx:hasVariant [affx:representedBy :gi18481728] .

:gi1144349 a affx:Transcript ;
	affx:unigene "iMm.184351" ;
	affx:translatesTo "MVAFKGVWTQAFWKAVSAEFLATLIFVLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV" ;
	affx:hasCds [affx:startsAt "15453814" ;
			affx:stopsAt "15460446" ];
	affx:hasExon [ affx:relatesToExon :Gene3012_e3;
		affx:cdsType "Partial" ;
		affx:cdsStart "15453814" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e4;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e5;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e7;
		affx:cdsType "Partial" ;
		affx:cdsStop "15460359" ;
		affx:frame "1"] ;
	affx:tmHMMHit [  affx:commonToAll "0" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "33" ;
				affx:spannedBy [ affx:startsAt "15460362" ;
					affx:stopsAt "15460446" ;
					affx:inFrame "2" ] ;
				affx:spannedBy [ affx:startsAt "15460344" ;
					affx:stopsAt "15460359" ;
					affx:inFrame "1" ] ;
			] ;
		] ;
	affx:tmHMMHit [  affx:commonToAll "0" ;
		affx:motifCount "5" ;
		affx:containsMotif [ affx:startsAt "49" ;
				affx:stopsAt "71" ;
				affx:spannedBy [ affx:startsAt "15460230" ;
					affx:stopsAt "15460296" ;
					affx:inFrame "1" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "92" ;
				affx:stopsAt "114" ;
				affx:spannedBy [ affx:startsAt "15460101" ;
					affx:stopsAt "15460167" ;
					affx:inFrame "1" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "134" ;
				affx:stopsAt "153" ;
				affx:spannedBy [ affx:startsAt "15458652" ;
					affx:stopsAt "15458709" ;
					affx:inFrame "0" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "166" ;
				affx:stopsAt "188" ;
				affx:spannedBy [ affx:startsAt "15458568" ;
					affx:stopsAt "15458613" ;
					affx:inFrame "0" ] ;
				affx:spannedBy [ affx:startsAt "15458116" ;
					affx:stopsAt "15458137" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "208" ;
				affx:stopsAt "230" ;
				affx:spannedBy [ affx:startsAt "15454027" ;
					affx:stopsAt "15454093" ;
					affx:inFrame "1" ] ;
			] ;
		] ;
	.

:gi1808953 a affx:Transcript ;
	affx:unigene "iMm.184351" ;
	affx:translatesTo "MVHGFGCFVFFFLISLSSLWASEDSTCNSTLPLCHLATTLDCCKCGHSCSRESIMVAFKGVWTQAFWKAVSAEFLATLIFVLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV" ;
	affx:hasCds [affx:startsAt "15453814" ;
			affx:stopsAt "15463470" ];
	affx:hasExon [ affx:relatesToExon :Gene3012_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "15453814" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e6;
		affx:cdsType "Partial" ;
		affx:cdsStop "15460359" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e8;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e10;
		affx:cdsType "Partial" ;
		affx:cdsStop "15463470" ;
		affx:frame "2"] ;
	affx:tmHMMHit [  affx:commonToAll "0" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "21" ;
				affx:spannedBy [ affx:startsAt "15463425" ;
					affx:stopsAt "15463470" ;
					affx:inFrame "2" ] ;
				affx:spannedBy [ affx:startsAt "15463201" ;
					affx:stopsAt "15463219" ;
					affx:inFrame "0" ] ;
			] ;
		] ;
	affx:tmHMMHit [  affx:commonToAll "0" ;
		affx:motifCount "6" ;
		affx:containsMotif [ affx:startsAt "69" ;
				affx:stopsAt "91" ;
				affx:spannedBy [ affx:startsAt "15460362" ;
					affx:stopsAt "15460401" ;
					affx:inFrame "0" ] ;
				affx:spannedBy [ affx:startsAt "15460332" ;
					affx:stopsAt "15460359" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "101" ;
				affx:stopsAt "123" ;
				affx:spannedBy [ affx:startsAt "15460236" ;
					affx:stopsAt "15460302" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "143" ;
				affx:stopsAt "165" ;
				affx:spannedBy [ affx:startsAt "15460110" ;
					affx:stopsAt "15460176" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "185" ;
				affx:stopsAt "207" ;
				affx:spannedBy [ affx:startsAt "15458652" ;
					affx:stopsAt "15458718" ;
					affx:inFrame "1" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "220" ;
				affx:stopsAt "242" ;
				affx:spannedBy [ affx:startsAt "15458568" ;
					affx:stopsAt "15458613" ;
					affx:inFrame "1" ] ;
				affx:spannedBy [ affx:startsAt "15458116" ;
					affx:stopsAt "15458137" ;
					affx:inFrame "0" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "262" ;
				affx:stopsAt "284" ;
				affx:spannedBy [ affx:startsAt "15454027" ;
					affx:stopsAt "15454093" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	.

:gi18481726 a affx:Transcript ;
	affx:unigene "iMm.184351" ;
	affx:translatesTo "MSDRAAARRWGKCGHSCSRESIMVAFKGVWTQAFWKAVSAEFLATLIFVLLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV" ;
	affx:hasCds [affx:startsAt "15453814" ;
			affx:stopsAt "15464109" ];
	affx:hasExon [ affx:relatesToExon :Gene3012_e3;
		affx:cdsType "Partial" ;
		affx:cdsStart "15453814" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e4;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e5;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e6;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e11;
		affx:cdsType "Partial" ;
		affx:cdsStop "15464109" ;
		affx:frame "1"] ;
	affx:tmHMMHit [  affx:commonToAll "0" ;
		affx:motifCount "6" ;
		affx:containsMotif [ affx:startsAt "33" ;
				affx:stopsAt "55" ;
				affx:spannedBy [ affx:startsAt "15460347" ;
					affx:stopsAt "15460413" ;
					affx:inFrame "1" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "70" ;
				affx:stopsAt "92" ;
				affx:spannedBy [ affx:startsAt "15460236" ;
					affx:stopsAt "15460302" ;
					affx:inFrame "1" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "112" ;
				affx:stopsAt "134" ;
				affx:spannedBy [ affx:startsAt "15460110" ;
					affx:stopsAt "15460176" ;
					affx:inFrame "1" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "154" ;
				affx:stopsAt "176" ;
				affx:spannedBy [ affx:startsAt "15458652" ;
					affx:stopsAt "15458718" ;
					affx:inFrame "0" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "189" ;
				affx:stopsAt "211" ;
				affx:spannedBy [ affx:startsAt "15458568" ;
					affx:stopsAt "15458613" ;
					affx:inFrame "0" ] ;
				affx:spannedBy [ affx:startsAt "15458116" ;
					affx:stopsAt "15458137" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "231" ;
				affx:stopsAt "253" ;
				affx:spannedBy [ affx:startsAt "15454027" ;
					affx:stopsAt "15454093" ;
					affx:inFrame "1" ] ;
			] ;
		] ;
	.

:gi18481728 a affx:Transcript ;
	affx:unigene "iMm.184351" ;
	affx:translatesTo "MVAFKGVWTQAFWKAVSAEFLATLIFVLLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMGAVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV" ;
	affx:hasCds [affx:startsAt "15453814" ;
			affx:stopsAt "15460446" ];
	affx:hasExon [ affx:relatesToExon :Gene3012_e3;
		affx:cdsType "Partial" ;
		affx:cdsStart "15453814" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e6;
		affx:cdsType "Partial" ;
		affx:cdsStop "15460446" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3012_e9;
		affx:cdsType "None" ] ;
	affx:tmHMMHit [  affx:commonToAll "0" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "34" ;
				affx:spannedBy [ affx:startsAt "15460344" ;
					affx:stopsAt "15460446" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	affx:tmHMMHit [  affx:commonToAll "0" ;
		affx:motifCount "5" ;
		affx:containsMotif [ affx:startsAt "50" ;
				affx:stopsAt "72" ;
				affx:spannedBy [ affx:startsAt "15460230" ;
					affx:stopsAt "15460296" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "93" ;
				affx:stopsAt "115" ;
				affx:spannedBy [ affx:startsAt "15460101" ;
					affx:stopsAt "15460167" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "135" ;
				affx:stopsAt "154" ;
				affx:spannedBy [ affx:startsAt "15458652" ;
					affx:stopsAt "15458709" ;
					affx:inFrame "1" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "167" ;
				affx:stopsAt "189" ;
				affx:spannedBy [ affx:startsAt "15458568" ;
					affx:stopsAt "15458613" ;
					affx:inFrame "1" ] ;
				affx:spannedBy [ affx:startsAt "15458116" ;
					affx:stopsAt "15458137" ;
					affx:inFrame "0" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "209" ;
				affx:stopsAt "231" ;
				affx:spannedBy [ affx:startsAt "15454027" ;
					affx:stopsAt "15454093" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	.

:Gene3012_e1 a affx:Exon ; 
	affx:startsAt "15453174" ; 
	affx:stopsAt "15453255" ; 
	affx:commonToAll "0" .

:Gene3012_e2 a affx:Exon ; 
	affx:startsAt "15453666" ; 
	affx:stopsAt "15454093" ; 
	affx:commonToAll "0" .

:Gene3012_e3 a affx:Exon ; 
	affx:startsAt "15453807" ; 
	affx:stopsAt "15454093" ; 
	affx:commonToAll "0" .

:Gene3012_e4 a affx:Exon ; 
	affx:startsAt "15458056" ; 
	affx:stopsAt "15458137" ; 
	affx:commonToAll "1" .

:Gene3012_e5 a affx:Exon ; 
	affx:startsAt "15458568" ; 
	affx:stopsAt "15458733" ; 
	affx:commonToAll "1" .

:Gene3012_e6 a affx:Exon ; 
	affx:startsAt "15460065" ; 
	affx:stopsAt "15460480" ; 
	affx:commonToAll "0" .

:Gene3012_e7 a affx:Exon ; 
	affx:startsAt "15460065" ; 
	affx:stopsAt "15460529" ; 
	affx:commonToAll "0" .

:Gene3012_e8 a affx:Exon ; 
	affx:startsAt "15463136" ; 
	affx:stopsAt "15463219" ; 
	affx:commonToAll "0" .

:Gene3012_e9 a affx:Exon ; 
	affx:startsAt "15463136" ; 
	affx:stopsAt "15463477" ; 
	affx:commonToAll "0" .

:Gene3012_e10 a affx:Exon ; 
	affx:startsAt "15463425" ; 
	affx:stopsAt "15463494" ; 
	affx:commonToAll "0" .

:Gene3012_e11 a affx:Exon ; 
	affx:startsAt "15464077" ; 
	affx:stopsAt "15464236" ; 
	affx:commonToAll "0" .

:Gene3013 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi16741529] .

:gi16741529 a affx:Transcript ;
	affx:unigene "iMm.182574" ;
	affx:translatesTo "MAAAEPSVAALAGGGVGAGAPSGGVPVLFCFSVFARPASVPHGAGYDVLIQKFLSLYGDQLDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKLRLVPLQIQLTTLGNLTPPSTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIITEQYPKGLGSTVQEIDLTGVKLVLPKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV" ;
	affx:hasCds [affx:startsAt "58948819" ;
			affx:stopsAt "58967277" ];
	affx:hasExon [ affx:relatesToExon :Gene3013_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "58948819" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3013_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3013_e3;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3013_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3013_e5;
		affx:cdsType "Partial" ;
		affx:cdsStop "58967277" ;
		affx:frame "1"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "7" ;
				affx:stopsAt "29" ;
				affx:spannedBy [ affx:startsAt "58948840" ;
					affx:stopsAt "58948906" ;
					affx:inFrame "0" ] ;
			] ;
		] ;
	.

:Gene3013_e1 a affx:Exon ; 
	affx:startsAt "58948802" ; 
	affx:stopsAt "58949125" ; 
	affx:commonToAll "1" .

:Gene3013_e2 a affx:Exon ; 
	affx:startsAt "58960572" ; 
	affx:stopsAt "58960692" ; 
	affx:commonToAll "1" .

:Gene3013_e3 a affx:Exon ; 
	affx:startsAt "58960812" ; 
	affx:stopsAt "58961016" ; 
	affx:commonToAll "1" .

:Gene3013_e4 a affx:Exon ; 
	affx:startsAt "58962614" ; 
	affx:stopsAt "58962731" ; 
	affx:commonToAll "1" .

:Gene3013_e5 a affx:Exon ; 
	affx:startsAt "58967130" ; 
	affx:stopsAt "58967641" ; 
	affx:commonToAll "1" .

:Gene3014 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi15928531] .

:gi15928531 a affx:Transcript ;
	affx:unigene "iMm.30234" ;
	affx:translatesTo "MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSAPPSKSRHHEMPREYNEDEDPAARRRKKKSYYAKLRQQEIERERELAEKYRDRAKERRDGVNKDYEETELISTTANYRAVGPTAEADKSAAEKRRQLIQESKFLGGDMEHTHLVKGLDFALLQKVRAEIASKEKEEEELMEKPQKETKKDEDPENKIEFKTRLGRNVYRMLFKSKSYERNELFLPGRMAYVVDLDDEYADTDIPTTLIRSKADCPTMEAQTTLTTNDIVISKLTQILSYLRQGTRNKKLKKKDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRERDRDRERDRERDRERERERDREREREEEKKRHSYFEKPKVDDEPMDVDKGPGSAKELIKSINEKFAGSAGWEGTESLKKPEDKKQLGDFFGMSNSYAECYPATMDDMAVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPKY" ;
	affx:hasCds [affx:startsAt "36932042" ;
			affx:stopsAt "36944707" ];
	affx:hasExon [ affx:relatesToExon :Gene3014_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "36932042" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e2;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e4;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e5;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e7;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e8;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e9;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e10;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e11;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e12;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e13;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e14;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e15;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e16;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e17;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e18;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e19;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3014_e20;
		affx:cdsType "Partial" ;
		affx:cdsStop "36944707" ;
		affx:frame "2"] ;
	.

:Gene3014_e1 a affx:Exon ; 
	affx:startsAt "36931994" ; 
	affx:stopsAt "36932058" ; 
	affx:commonToAll "1" .

:Gene3014_e2 a affx:Exon ; 
	affx:startsAt "36932880" ; 
	affx:stopsAt "36932947" ; 
	affx:commonToAll "1" .

:Gene3014_e3 a affx:Exon ; 
	affx:startsAt "36934620" ; 
	affx:stopsAt "36934713" ; 
	affx:commonToAll "1" .

:Gene3014_e4 a affx:Exon ; 
	affx:startsAt "36935436" ; 
	affx:stopsAt "36935496" ; 
	affx:commonToAll "1" .

:Gene3014_e5 a affx:Exon ; 
	affx:startsAt "36935823" ; 
	affx:stopsAt "36935991" ; 
	affx:commonToAll "1" .

:Gene3014_e6 a affx:Exon ; 
	affx:startsAt "36936143" ; 
	affx:stopsAt "36936258" ; 
	affx:commonToAll "1" .

:Gene3014_e7 a affx:Exon ; 
	affx:startsAt "36936486" ; 
	affx:stopsAt "36936557" ; 
	affx:commonToAll "1" .

:Gene3014_e8 a affx:Exon ; 
	affx:startsAt "36936663" ; 
	affx:stopsAt "36936710" ; 
	affx:commonToAll "1" .

:Gene3014_e9 a affx:Exon ; 
	affx:startsAt "36938376" ; 
	affx:stopsAt "36938540" ; 
	affx:commonToAll "1" .

:Gene3014_e10 a affx:Exon ; 
	affx:startsAt "36939629" ; 
	affx:stopsAt "36939738" ; 
	affx:commonToAll "1" .

:Gene3014_e11 a affx:Exon ; 
	affx:startsAt "36940534" ; 
	affx:stopsAt "36940574" ; 
	affx:commonToAll "1" .

:Gene3014_e12 a affx:Exon ; 
	affx:startsAt "36940699" ; 
	affx:stopsAt "36940925" ; 
	affx:commonToAll "1" .

:Gene3014_e13 a affx:Exon ; 
	affx:startsAt "36941164" ; 
	affx:stopsAt "36941183" ; 
	affx:commonToAll "1" .

:Gene3014_e14 a affx:Exon ; 
	affx:startsAt "36941825" ; 
	affx:stopsAt "36941904" ; 
	affx:commonToAll "1" .

:Gene3014_e15 a affx:Exon ; 
	affx:startsAt "36942697" ; 
	affx:stopsAt "36942778" ; 
	affx:commonToAll "1" .

:Gene3014_e16 a affx:Exon ; 
	affx:startsAt "36942969" ; 
	affx:stopsAt "36943027" ; 
	affx:commonToAll "1" .

:Gene3014_e17 a affx:Exon ; 
	affx:startsAt "36943820" ; 
	affx:stopsAt "36943909" ; 
	affx:commonToAll "1" .

:Gene3014_e18 a affx:Exon ; 
	affx:startsAt "36944094" ; 
	affx:stopsAt "36944203" ; 
	affx:commonToAll "1" .

:Gene3014_e19 a affx:Exon ; 
	affx:startsAt "36944556" ; 
	affx:stopsAt "36944591" ; 
	affx:commonToAll "1" .

:Gene3014_e20 a affx:Exon ; 
	affx:startsAt "36944679" ; 
	affx:stopsAt "36944908" ; 
	affx:commonToAll "1" .

:Gene3015 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi16359233] .

:gi16359233 a affx:Transcript ;
	affx:unigene "iMm.192285" ;
	affx:translatesTo "MAFFVKNMISNQVKNLGFGGGSEEKKEEGGTSDPAAAKGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLRDKYRLPKSEMDETQIQLAGDDVDLPEDLRKMVDEDQDEEEEKDSILGQLQNLQNMDLDTIKEKAQATFTEIKQSAEQKCSVM" ;
	affx:hasCds [affx:startsAt "66295576" ;
			affx:stopsAt "66309447" ];
	affx:hasExon [ affx:relatesToExon :Gene3015_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "66295576" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3015_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3015_e3;
		affx:cdsType "Partial" ;
		affx:cdsStop "66309447" ;
		affx:frame "1"] ;
	.

:Gene3015_e1 a affx:Exon ; 
	affx:startsAt "66294434" ; 
	affx:stopsAt "66295804" ; 
	affx:commonToAll "1" .

:Gene3015_e2 a affx:Exon ; 
	affx:startsAt "66306868" ; 
	affx:stopsAt "66306956" ; 
	affx:commonToAll "1" .

:Gene3015_e3 a affx:Exon ; 
	affx:startsAt "66309280" ; 
	affx:stopsAt "66309578" ; 
	affx:commonToAll "1" .

:Gene3016 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi16359235] .

:gi16359235 a affx:Transcript ;
	affx:unigene "iMm.29866" ;
	affx:translatesTo "MVCIPCIVIPVLLWIFKKFLEPYIYPVVSRIWPKKAVQQSGDKNMSKVDCKGAGTNGLPTKGPTEVSDKKKD" ;
	affx:hasCds [affx:startsAt "75385734" ;
			affx:stopsAt "75386404" ];
	affx:hasExon [ affx:relatesToExon :Gene3016_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3016_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "75385734" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3016_e3;
		affx:cdsType "Partial" ;
		affx:cdsStop "75386404" ;
		affx:frame "1"] ;
	.

:Gene3016_e1 a affx:Exon ; 
	affx:startsAt "75382650" ; 
	affx:stopsAt "75382865" ; 
	affx:commonToAll "1" .

:Gene3016_e2 a affx:Exon ; 
	affx:startsAt "75385711" ; 
	affx:stopsAt "75385887" ; 
	affx:commonToAll "1" .

:Gene3016_e3 a affx:Exon ; 
	affx:startsAt "75386338" ; 
	affx:stopsAt "75386994" ; 
	affx:commonToAll "1" .

:Gene3017 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi15420534] .

:gi15420534 a affx:Transcript ;
	affx:unigene "iMm.207073" ;
	affx:translatesTo "MSESNSTGILPPAAQVPLAFLMSSFAFAIMVGNAVVILAFVVDRNLRHRSNYFFLNLAISDFLVGLISIPLYIPHVLFNWNFGSGICMFWLITDYLLCTASVYNIVLISYDRYQSVSNAVSYRAQHTGIMKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTKDCEPGFVTEWYILTITMLLEFLLPVISVAYFNVQIYWSLWKRRALSRCPSHAGFSTTSSSASGHLHRAGVACRTSNPGLKESAASRHSESPRRKSSILVSLRTHMNSSITAFKVGSFWRSESAALRQREYAELLRGRKLARSLAILLSAFAICWAPYCLFTIVLSTYPRTERPKSVWYSIAFWLQWFNSFVNPFLYPLCHRRFQKAFWKILCVTKQPALSQNQSVSS" ;
	affx:hasCds [affx:startsAt "13024215" ;
			affx:stopsAt "13039929" ];
	affx:hasExon [ affx:relatesToExon :Gene3017_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "13024215" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3017_e2;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3017_e3;
		affx:cdsType "Partial" ;
		affx:cdsStop "13039929" ;
		affx:frame "2"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "34" ;
				affx:spannedBy [ affx:startsAt "13024215" ;
					affx:stopsAt "13024317" ;
					affx:inFrame "0" ] ;
			] ;
		] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "5" ;
		affx:containsMotif [ affx:startsAt "54" ;
				affx:stopsAt "76" ;
				affx:spannedBy [ affx:startsAt "13024377" ;
					affx:stopsAt "13024408" ;
					affx:inFrame "0" ] ;
				affx:spannedBy [ affx:startsAt "13033053" ;
					affx:stopsAt "13033088" ;
					affx:inFrame "0" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "86" ;
				affx:stopsAt "108" ;
				affx:spannedBy [ affx:startsAt "13033118" ;
					affx:stopsAt "13033184" ;
					affx:inFrame "0" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "132" ;
				affx:stopsAt "154" ;
				affx:spannedBy [ affx:startsAt "13039149" ;
					affx:stopsAt "13039215" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "174" ;
				affx:stopsAt "196" ;
				affx:spannedBy [ affx:startsAt "13039275" ;
					affx:stopsAt "13039341" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "341" ;
				affx:stopsAt "363" ;
				affx:spannedBy [ affx:startsAt "13039776" ;
					affx:stopsAt "13039842" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	.

:Gene3017_e1 a affx:Exon ; 
	affx:startsAt "13024155" ; 
	affx:stopsAt "13024408" ; 
	affx:commonToAll "1" .

:Gene3017_e2 a affx:Exon ; 
	affx:startsAt "13033053" ; 
	affx:stopsAt "13033217" ; 
	affx:commonToAll "1" .

:Gene3017_e3 a affx:Exon ; 
	affx:startsAt "13039110" ; 
	affx:stopsAt "13040230" ; 
	affx:commonToAll "1" .

:Gene3018 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi13936901] ;
	affx:hasVariant [affx:representedBy :gi13936903] ;
	affx:hasVariant [affx:representedBy :gi13936905] ;
	affx:hasVariant [affx:representedBy :gi13936907] .

:gi13936901 a affx:Transcript ;
	affx:unigene "iMm.179740" ;
	affx:translatesTo "MISSKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDIKDLIKQFHQMKVEKWAEGVTVEKKECIKEPIKPPPVPCKPTHMEKSTDTEEDNVAGPLFSNKTTQFPSVHAEVQSEETSEGARGPSDKPTTPKTDYTPPSSPPPAPVSAEYAYVPADPAQFAAQMLGNVPSTYSEVLMVDVATSTPAVPQDVLSAEFAEEVVLSAPLVCSGETVEVQVVSKTSAQVVVGPVSEAEPPKASSAPLQGEQEPPAHEAPDTQVTSASRISSIYNDVPVNEGVVYVEEIPGYIVIPFTDHDQVACVKEIEQSPPGSPKAVEPKTKISIESLKTVQVEENSQHKSSVHVEAEATVLLSNTALDGQPEVPAEPLDAEGFFKVASENSLHLETEIVIINPDDPGQEESGGNAAPHSSGDPFPPAPGGLTEPEMQPDGEAAPEQV" ;
	affx:hasCds [affx:startsAt "12760066" ;
			affx:stopsAt "12767369" ];
	affx:hasExon [ affx:relatesToExon :Gene3018_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "12760066" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e5;
		affx:cdsType "Partial" ;
		affx:cdsStop "12767369" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e6;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e8;
		affx:cdsType "None" ] ;
	.

:gi13936903 a affx:Transcript ;
	affx:unigene "iMm.179740" ;
	affx:translatesTo "MISSKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDIKDLIKQFHQMKVEKWAEGVTVEKKECIKEPIKPPPVPCKPTHMEKSTDTEEDNVAGPLFSNKTTQFPSVHAEVQSEETSEGARGPSDKPTTPKTDYTPPSSPPPAPVSAEYAYVPADPAQFAAQMLALATSEAGQPPPYSNMWTLYCLTDMNQQSRPSPPPAPGPFPQATLYLPNPKEPQFLQNPPKVTSPTYVMMDDSKKTNAPPFILVGSNVQEAQDWNPLPGHAVVSQAEALKRYAAVQVPIAVPADQTFQRPAPNPQNASPPTSGQDGPRPKSPVFLSVAFPVEDVAKKSSGSGDKRTPFGSYGIAGEITVTTAHVRRAEP" ;
	affx:hasCds [affx:startsAt "12760066" ;
			affx:stopsAt "12770009" ];
	affx:hasExon [ affx:relatesToExon :Gene3018_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "12760066" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e4;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e6;
		affx:cdsType "Partial" ;
		affx:cdsStop "12770009" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e8;
		affx:cdsType "None" ] ;
	.

:gi13936905 a affx:Transcript ;
	affx:unigene "iMm.179740" ;
	affx:translatesTo "MISSKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDIKDLIKQFHQMKVEKWAEGVTVEKKECIKEPIKPPPVPCKPTHMEKSTDTEEDNVAGPLFSNKTTQFPSVHAEVQSEETSEGARGPSDKPTTPKTDYTPPSSPPPAPVSAEYAYVPADPAQFAAQMLEDVAKKSSGSGDKRTPFGSYGIAGEITVTTAHVRRAEP" ;
	affx:hasCds [affx:startsAt "12760066" ;
			affx:stopsAt "12770009" ];
	affx:hasExon [ affx:relatesToExon :Gene3018_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "12760066" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e4;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e7;
		affx:cdsType "Partial" ;
		affx:cdsStop "12770009" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e8;
		affx:cdsType "None" ] ;
	.

:gi13936907 a affx:Transcript ;
	affx:unigene "iMm.179740" ;
	affx:translatesTo "MISSKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDIKDLIKQFHQMKVEKWAEGVTVEKKECIKEPIKPPPVPCKPTHMEKSTDTEEDNVAGPLFSNKTTQFPSVHAEVQSEETSEGARGPSDKPTTPKTDYTPPSSPPPAPVSAEYAYVPADPAQFAAQMLGNVPSTYSEVLMVDVATSTPAVPQDVLSAEFAEEVVLSAPLVCSGETVEVQVVSKTSAQVVVGPVSEAEPPKASSAPLQGEQEPPAHEAPDTQVTSASRISSIYNDVPVNEGVVYVEEIPGYIVIPFTDHDQVACVKEIEQSPPGSPKAVEPKTKISIESLKTVQVEENSQHKSSVHVEAEATVLLSNTALDGQPEVPAEPLDAEGFFKVASENSLHLETEIVIINPDDPGQEESGGNAAPHSSGDPFPPAPGGLTEPEMQPDGEAAPEQV" ;
	affx:hasCds [affx:startsAt "12760066" ;
			affx:stopsAt "12767369" ];
	affx:hasExon [ affx:relatesToExon :Gene3018_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "12760066" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e5;
		affx:cdsType "Partial" ;
		affx:cdsStop "12767369" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e7;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3018_e8;
		affx:cdsType "None" ] ;
	.

:Gene3018_e1 a affx:Exon ; 
	affx:startsAt "12756904" ; 
	affx:stopsAt "12756951" ; 
	affx:commonToAll "1" .

:Gene3018_e2 a affx:Exon ; 
	affx:startsAt "12760041" ; 
	affx:stopsAt "12760214" ; 
	affx:commonToAll "1" .

:Gene3018_e3 a affx:Exon ; 
	affx:startsAt "12760305" ; 
	affx:stopsAt "12760359" ; 
	affx:commonToAll "1" .

:Gene3018_e4 a affx:Exon ; 
	affx:startsAt "12766209" ; 
	affx:stopsAt "12766554" ; 
	affx:commonToAll "0" .

:Gene3018_e5 a affx:Exon ; 
	affx:startsAt "12766209" ; 
	affx:stopsAt "12767378" ; 
	affx:commonToAll "0" .

:Gene3018_e6 a affx:Exon ; 
	affx:startsAt "12769410" ; 
	affx:stopsAt "12770013" ; 
	affx:commonToAll "0" .

:Gene3018_e7 a affx:Exon ; 
	affx:startsAt "12769893" ; 
	affx:stopsAt "12770013" ; 
	affx:commonToAll "0" .

:Gene3018_e8 a affx:Exon ; 
	affx:startsAt "12770613" ; 
	affx:stopsAt "12770692" ; 
	affx:commonToAll "1" .

:Gene3019 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi13097485] .

:gi13097485 a affx:Transcript ;
	affx:unigene "iMm.7043" ;
	affx:translatesTo "MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLAGQATTAYFLYQQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL" ;
	affx:hasCds [affx:startsAt "61098077" ;
			affx:stopsAt "61106306" ];
	affx:hasExon [ affx:relatesToExon :Gene3019_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "61098077" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3019_e2;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3019_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3019_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3019_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3019_e6;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3019_e7;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3019_e8;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3019_e9;
		affx:cdsType "Partial" ;
		affx:cdsStop "61106306" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3019_e10;
		affx:cdsType "None" ] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "32" ;
				affx:stopsAt "54" ;
				affx:spannedBy [ affx:startsAt "61102070" ;
					affx:stopsAt "61102136" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	.

:Gene3019_e1 a affx:Exon ; 
	affx:startsAt "61097998" ; 
	affx:stopsAt "61098154" ; 
	affx:commonToAll "1" .

:Gene3019_e2 a affx:Exon ; 
	affx:startsAt "61102051" ; 
	affx:stopsAt "61102221" ; 
	affx:commonToAll "1" .

:Gene3019_e3 a affx:Exon ; 
	affx:startsAt "61102375" ; 
	affx:stopsAt "61102455" ; 
	affx:commonToAll "1" .

:Gene3019_e4 a affx:Exon ; 
	affx:startsAt "61103171" ; 
	affx:stopsAt "61103234" ; 
	affx:commonToAll "1" .

:Gene3019_e5 a affx:Exon ; 
	affx:startsAt "61104125" ; 
	affx:stopsAt "61104218" ; 
	affx:commonToAll "1" .

:Gene3019_e6 a affx:Exon ; 
	affx:startsAt "61104471" ; 
	affx:stopsAt "61104562" ; 
	affx:commonToAll "1" .

:Gene3019_e7 a affx:Exon ; 
	affx:startsAt "61105437" ; 
	affx:stopsAt "61105629" ; 
	affx:commonToAll "1" .

:Gene3019_e8 a affx:Exon ; 
	affx:startsAt "61106002" ; 
	affx:stopsAt "61106065" ; 
	affx:commonToAll "1" .

:Gene3019_e9 a affx:Exon ; 
	affx:startsAt "61106295" ; 
	affx:stopsAt "61106507" ; 
	affx:commonToAll "1" .

:Gene3019_e10 a affx:Exon ; 
	affx:startsAt "61106564" ; 
	affx:stopsAt "61106794" ; 
	affx:commonToAll "1" .

:Gene3020 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi17390413] .

:gi17390413 a affx:Transcript ;
	affx:unigene "iMm.214768" ;
	affx:translatesTo "MANDIDELIGIPFPNHSSEVLCSLNEQRHAGLLCDVLLVVQEQEYRTHRSVLAACSKYFKKLFTAGSLASQPYVYEIDFVQPEALAAILEFAYTSTLTITASNVKHILNAARMLEIQCIVNVCLEIMEPGGSVGEEDDKEEEDEDDDDEDEDDEEEEEEEEEEEEDDPEDFADQENLPDPQDITCPQSPSKTDHLTEKDYSDTPRDFPDSFQPGSPGHLGVIRDFSIESLLRENLYPKANIPDRRPYLSPFAPEFFPHLWPGGFGAFAQLPEQPMDSGPLDLVIKNRKIKEEDKEELAPPPPPPFSSDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGSLFPPWPLVEERKLKPKASQQCPICHKVIMGAGKLPRHMRTHTGEKPYMCSICEVRFTRQDKLKIHMRKHTGERPYLCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRGRKPAAWRAASLLFGPGGPSADKAAFVMPPALGDVGGHLGGTAVCLPGPSPAKHFLASPKGTLSLQELERQFEETQMKLFGRAQLEAERNAGGLLALALAENVAATRPYFPLPDPWAAGLAGLPGLTGLNHVASMSEANN" ;
	affx:hasCds [affx:startsAt "76515185" ;
			affx:stopsAt "76524842" ];
	affx:hasExon [ affx:relatesToExon :Gene3020_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3020_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "76515185" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3020_e3;
		affx:cdsType "Partial" ;
		affx:cdsStop "76524842" ;
		affx:frame "2"] ;
	.

:Gene3020_e1 a affx:Exon ; 
	affx:startsAt "76437529" ; 
	affx:stopsAt "76437689" ; 
	affx:commonToAll "1" .

:Gene3020_e2 a affx:Exon ; 
	affx:startsAt "76515169" ; 
	affx:stopsAt "76516393" ; 
	affx:commonToAll "1" .

:Gene3020_e3 a affx:Exon ; 
	affx:startsAt "76524190" ; 
	affx:stopsAt "76524964" ; 
	affx:commonToAll "1" .

:Gene3021 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi17390498] .

:gi17390498 a affx:Transcript ;
	affx:unigene "iMm.4471" ;
	affx:translatesTo "MVVFLSCQLFHKEVLRQSISHKYLMQGPCLPYTSKLVKTLLYNFIRQEKPPPPGTHVFPQQSDGGGLLYGLASGVATGLWTVFTLGGAGSKAAASPELTSPLANQSLLLLLVLVNLTDAPDIPNPYRQAVSSFKNTQDSSPFPSSIPHTFQINFNSLYTALCEQQTSDQATLLLYTLLHQNSNVRTYVLARTDMENLVLPILEILYHVEERNSHHVYMALIILLILTEDDGFNRSIHEVILRNITWYSERVLTEISLGSLLILVVIRTIQYNMTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRIISLFSLLSKKHNKVLEQATQSLRGPLSSSDVPLPDYAQDLSVIEEVIRMMLEIINSCLTNSLHHNPNLVYALLYKRDLFEQFRTHPSFQDIMQNIDLVISFFSSRLLQAGAELSVERVLEIIKQGVVALPKDRLKKFPELKFKYVEEEQPEEFFIPYVWSLVYNSAVGLYWNPQDIQLFAMDSD" ;
	affx:hasCds [affx:startsAt "75457712" ;
			affx:stopsAt "75664815" ];
	affx:hasExon [ affx:relatesToExon :Gene3021_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e2;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e3;
		affx:cdsType "Partial" ;
		affx:cdsStart "75457712" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e4;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e6;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e7;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e8;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e9;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e10;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e11;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e12;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3021_e13;
		affx:cdsType "Partial" ;
		affx:cdsStop "75664815" ;
		affx:frame "1"] ;
	.

:Gene3021_e1 a affx:Exon ; 
	affx:startsAt "75434033" ; 
	affx:stopsAt "75434078" ; 
	affx:commonToAll "1" .

:Gene3021_e2 a affx:Exon ; 
	affx:startsAt "75440586" ; 
	affx:stopsAt "75440659" ; 
	affx:commonToAll "1" .

:Gene3021_e3 a affx:Exon ; 
	affx:startsAt "75457672" ; 
	affx:stopsAt "75457798" ; 
	affx:commonToAll "1" .

:Gene3021_e4 a affx:Exon ; 
	affx:startsAt "75459834" ; 
	affx:stopsAt "75459977" ; 
	affx:commonToAll "1" .

:Gene3021_e5 a affx:Exon ; 
	affx:startsAt "75492281" ; 
	affx:stopsAt "75492464" ; 
	affx:commonToAll "1" .

:Gene3021_e6 a affx:Exon ; 
	affx:startsAt "75496837" ; 
	affx:stopsAt "75497016" ; 
	affx:commonToAll "1" .

:Gene3021_e7 a affx:Exon ; 
	affx:startsAt "75501184" ; 
	affx:stopsAt "75501310" ; 
	affx:commonToAll "1" .

:Gene3021_e8 a affx:Exon ; 
	affx:startsAt "75503150" ; 
	affx:stopsAt "75503264" ; 
	affx:commonToAll "1" .

:Gene3021_e9 a affx:Exon ; 
	affx:startsAt "75504551" ; 
	affx:stopsAt "75504646" ; 
	affx:commonToAll "1" .

:Gene3021_e10 a affx:Exon ; 
	affx:startsAt "75577331" ; 
	affx:stopsAt "75577434" ; 
	affx:commonToAll "1" .

:Gene3021_e11 a affx:Exon ; 
	affx:startsAt "75608217" ; 
	affx:stopsAt "75608400" ; 
	affx:commonToAll "1" .

:Gene3021_e12 a affx:Exon ; 
	affx:startsAt "75621512" ; 
	affx:stopsAt "75621626" ; 
	affx:commonToAll "1" .

:Gene3021_e13 a affx:Exon ; 
	affx:startsAt "75664665" ; 
	affx:stopsAt "75665012" ; 
	affx:commonToAll "1" .

:Gene3022 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18204787] .

:gi18204787 a affx:Transcript ;
	affx:unigene "iMm.218343" ;
	affx:translatesTo "MAVESRAISTLKPQDHQEELILVKIEDSSFSWSQKCKQNGSAQSCQELFRQQFRKFCYHETPGPREALGRLQELCHQWLMPELHTKEQILELLVLEQFLSILPEELKIWVQQHGPKSGEEAVTLLEDLEKEFDDPGQQVPDNLQGPSVSWKDLTYLKTSQDSTSIQVRPLKTQLKSWNPCLSSKSDAKNNESTAKEDISEEKAPELSWDPSCRGVSEHKSNLEWQQRSSPVHRGSFSQVIFTHKSLAKRDHLDESQRCLIISTNSVTCQKVSTDDRPYRCDVCGHSFKQHFSLTQHQRIHTGEKPYKCNQCGKAFSLRSYLIIHQKIHSGEKAYECNECGKAFN" ;
	affx:hasCds [affx:startsAt "24072342" ;
			affx:stopsAt "24076397" ];
	affx:hasExon [ affx:relatesToExon :Gene3022_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3022_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "24072342" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3022_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3022_e4;
		affx:cdsType "Partial" ;
		affx:cdsStop "24076397" ;
		affx:frame "1"] ;
	.

:Gene3022_e1 a affx:Exon ; 
	affx:startsAt "24070629" ; 
	affx:stopsAt "24070764" ; 
	affx:commonToAll "1" .

:Gene3022_e2 a affx:Exon ; 
	affx:startsAt "24072241" ; 
	affx:stopsAt "24072756" ; 
	affx:commonToAll "1" .

:Gene3022_e3 a affx:Exon ; 
	affx:startsAt "24072957" ; 
	affx:stopsAt "24073099" ; 
	affx:commonToAll "1" .

:Gene3022_e4 a affx:Exon ; 
	affx:startsAt "24075918" ; 
	affx:stopsAt "24078772" ; 
	affx:commonToAll "1" .

:Gene3023 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18204141] .

:gi18204141 a affx:Transcript ;
	affx:unigene "iMm.216371" ;
	affx:translatesTo "MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKHALYGDKKARKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLEKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRARIQSLPDLSRLPNVTGSHMHLPFAGDIYSED" ;
	affx:hasCds [affx:startsAt "24613530" ;
			affx:stopsAt "24653293" ];
	affx:hasExon [ affx:relatesToExon :Gene3023_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "24613530" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3023_e2;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3023_e3;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3023_e4;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3023_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3023_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3023_e7;
		affx:cdsType "Partial" ;
		affx:cdsStop "24653293" ;
		affx:frame "0"] ;
	.

:Gene3023_e1 a affx:Exon ; 
	affx:startsAt "24613291" ; 
	affx:stopsAt "24613680" ; 
	affx:commonToAll "1" .

:Gene3023_e2 a affx:Exon ; 
	affx:startsAt "24631233" ; 
	affx:stopsAt "24631409" ; 
	affx:commonToAll "1" .

:Gene3023_e3 a affx:Exon ; 
	affx:startsAt "24631504" ; 
	affx:stopsAt "24631631" ; 
	affx:commonToAll "1" .

:Gene3023_e4 a affx:Exon ; 
	affx:startsAt "24632393" ; 
	affx:stopsAt "24632491" ; 
	affx:commonToAll "1" .

:Gene3023_e5 a affx:Exon ; 
	affx:startsAt "24632569" ; 
	affx:stopsAt "24632676" ; 
	affx:commonToAll "1" .

:Gene3023_e6 a affx:Exon ; 
	affx:startsAt "24634193" ; 
	affx:stopsAt "24634323" ; 
	affx:commonToAll "1" .

:Gene3023_e7 a affx:Exon ; 
	affx:startsAt "24653142" ; 
	affx:stopsAt "24653346" ; 
	affx:commonToAll "1" .

:Gene3024 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18256217] .

:gi18256217 a affx:Transcript ;
	affx:unigene "iMm.196596" ;
	affx:translatesTo "MGGEDYYLELCERPVQFEKANPVNCVFFDEANKQVFAVRSGGATGVVVKGPDDRNPISFRMDDRGEVKCIKFSLENKILAVQRTAKAVDFCNFIPDNSQLEYTQECKTKNANILGFCWTSSTEIVFITDQGIEFYQVMPEKRSLKLLKSHNINVNWYTYCPESAVILLSTTVLENVLQPFHFRAGTMSKLPKFEIELPAAPKSTKLSLSERDIAMATIYGQLYILFLRHHSRTSNSTGAEVVLYHLPREGACKKMHILKLNRTGKFALNVVDNLVVVHHQDTETSVIFDIRLRGEFDGTVTFHHPVLPARSIQPYEIPLAGPAAVTSQSPVPCKLYSSSWIVFQPDIIISASQGYLWNLQVKLQPIVNLLPDKGRLMDFLLQRKECKAVVLSVCSQMLSESDRATLPVIATVFDKLNHEYKKYLDADQSYTMAVEAGQSRSNPPLKRPVRTQAVVDQSDVYTQVLSPFVENKEMPHKFVIAVLMEYIRSLNQFQIPVQHYLHELVIKTLVQHNLFYMLHQFLQYHVLSDSKPLACLLLSLESFYPPAHQLSLDMLKRLSTANDEIVEVLLSKHQVLAALRFIRGIGGHDNISARKFLDAARQTDDVMLFYTIFRFFEQRNQRLRGNPNFTPGEHCEEHVAFFKQVFGEQALMRPTTF" ;
	affx:hasCds [affx:startsAt "12183346" ;
			affx:stopsAt "12204435" ];
	affx:hasExon [ affx:relatesToExon :Gene3024_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "12183346" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e6;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e7;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e8;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e9;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e10;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e11;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e12;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e13;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e14;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e15;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e16;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e17;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e18;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e19;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3024_e20;
		affx:cdsType "Partial" ;
		affx:cdsStop "12204435" ;
		affx:frame "0"] ;
	.

:Gene3024_e1 a affx:Exon ; 
	affx:startsAt "12183292" ; 
	affx:stopsAt "12183448" ; 
	affx:commonToAll "1" .

:Gene3024_e2 a affx:Exon ; 
	affx:startsAt "12183778" ; 
	affx:stopsAt "12183855" ; 
	affx:commonToAll "1" .

:Gene3024_e3 a affx:Exon ; 
	affx:startsAt "12186094" ; 
	affx:stopsAt "12186179" ; 
	affx:commonToAll "1" .

:Gene3024_e4 a affx:Exon ; 
	affx:startsAt "12190686" ; 
	affx:stopsAt "12190743" ; 
	affx:commonToAll "1" .

:Gene3024_e5 a affx:Exon ; 
	affx:startsAt "12192737" ; 
	affx:stopsAt "12192824" ; 
	affx:commonToAll "1" .

:Gene3024_e6 a affx:Exon ; 
	affx:startsAt "12193662" ; 
	affx:stopsAt "12193803" ; 
	affx:commonToAll "1" .

:Gene3024_e7 a affx:Exon ; 
	affx:startsAt "12194038" ; 
	affx:stopsAt "12194142" ; 
	affx:commonToAll "1" .

:Gene3024_e8 a affx:Exon ; 
	affx:startsAt "12195034" ; 
	affx:stopsAt "12195124" ; 
	affx:commonToAll "1" .

:Gene3024_e9 a affx:Exon ; 
	affx:startsAt "12195215" ; 
	affx:stopsAt "12195321" ; 
	affx:commonToAll "1" .

:Gene3024_e10 a affx:Exon ; 
	affx:startsAt "12196133" ; 
	affx:stopsAt "12196245" ; 
	affx:commonToAll "1" .

:Gene3024_e11 a affx:Exon ; 
	affx:startsAt "12198528" ; 
	affx:stopsAt "12198573" ; 
	affx:commonToAll "1" .

:Gene3024_e12 a affx:Exon ; 
	affx:startsAt "12198758" ; 
	affx:stopsAt "12198812" ; 
	affx:commonToAll "1" .

:Gene3024_e13 a affx:Exon ; 
	affx:startsAt "12199441" ; 
	affx:stopsAt "12199570" ; 
	affx:commonToAll "1" .

:Gene3024_e14 a affx:Exon ; 
	affx:startsAt "12200198" ; 
	affx:stopsAt "12200305" ; 
	affx:commonToAll "1" .

:Gene3024_e15 a affx:Exon ; 
	affx:startsAt "12202758" ; 
	affx:stopsAt "12202878" ; 
	affx:commonToAll "1" .

:Gene3024_e16 a affx:Exon ; 
	affx:startsAt "12203109" ; 
	affx:stopsAt "12203187" ; 
	affx:commonToAll "1" .

:Gene3024_e17 a affx:Exon ; 
	affx:startsAt "12203369" ; 
	affx:stopsAt "12203474" ; 
	affx:commonToAll "1" .

:Gene3024_e18 a affx:Exon ; 
	affx:startsAt "12203562" ; 
	affx:stopsAt "12203631" ; 
	affx:commonToAll "1" .

:Gene3024_e19 a affx:Exon ; 
	affx:startsAt "12203709" ; 
	affx:stopsAt "12203935" ; 
	affx:commonToAll "1" .

:Gene3024_e20 a affx:Exon ; 
	affx:startsAt "12204355" ; 
	affx:stopsAt "12204524" ; 
	affx:commonToAll "1" .

:Gene3025 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18490452] .

:gi18490452 a affx:Transcript ;
	affx:unigene "iMm.37975" ;
	affx:translatesTo "MFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD" ;
	affx:hasCds [affx:startsAt "14981010" ;
			affx:stopsAt "14997872" ];
	affx:hasExon [ affx:relatesToExon :Gene3025_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "14981010" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3025_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3025_e3;
		affx:cdsType "Partial" ;
		affx:cdsStop "14997872" ;
		affx:frame "2"] ;
	.

:Gene3025_e1 a affx:Exon ; 
	affx:startsAt "14980158" ; 
	affx:stopsAt "14981169" ; 
	affx:commonToAll "1" .

:Gene3025_e2 a affx:Exon ; 
	affx:startsAt "14985453" ; 
	affx:stopsAt "14985759" ; 
	affx:commonToAll "1" .

:Gene3025_e3 a affx:Exon ; 
	affx:startsAt "14997809" ; 
	affx:stopsAt "14997908" ; 
	affx:commonToAll "1" .

:Gene3026 a affx:Gene ;
	affx:strand "-" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18204478] .

:gi18204478 a affx:Transcript ;
	affx:unigene "iMm.28414" ;
	affx:translatesTo "MRSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAELIQAGHMDSRLDELCNDIAMKKKLEEEEAEVKRKATDAAYQARQAVKTPPRRLPTVMVRSPVDSASPGGDYPLGDLTPTTMEEATSGVTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPITDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLVNESEMPVPPGHLNSTGVLLEVGGVLPMIHGGEIQPTTSAVAASPAASGKLLVVPFMFIRKNIVILYFRPNYSF" ;
	affx:hasCds [affx:startsAt "34788531" ;
			affx:stopsAt "34802694" ];
	affx:hasExon [ affx:relatesToExon :Gene3026_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e2;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e3;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e4;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e5;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e6;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e7;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e8;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e9;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e10;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e11;
		affx:cdsType "Partial" ;
		affx:cdsStart "34788531" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e12;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e13;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e14;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e15;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e16;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e17;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e18;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3026_e19;
		affx:cdsType "Partial" ;
		affx:cdsStop "34802694" ;
		affx:frame "1"] ;
	.

:Gene3026_e1 a affx:Exon ; 
	affx:startsAt "34778631" ; 
	affx:stopsAt "34779047" ; 
	affx:commonToAll "1" .

:Gene3026_e2 a affx:Exon ; 
	affx:startsAt "34781008" ; 
	affx:stopsAt "34781053" ; 
	affx:commonToAll "1" .

:Gene3026_e3 a affx:Exon ; 
	affx:startsAt "34781477" ; 
	affx:stopsAt "34781582" ; 
	affx:commonToAll "1" .

:Gene3026_e4 a affx:Exon ; 
	affx:startsAt "34782512" ; 
	affx:stopsAt "34782690" ; 
	affx:commonToAll "1" .

:Gene3026_e5 a affx:Exon ; 
	affx:startsAt "34783403" ; 
	affx:stopsAt "34783472" ; 
	affx:commonToAll "1" .

:Gene3026_e6 a affx:Exon ; 
	affx:startsAt "34783636" ; 
	affx:stopsAt "34783729" ; 
	affx:commonToAll "1" .

:Gene3026_e7 a affx:Exon ; 
	affx:startsAt "34784280" ; 
	affx:stopsAt "34784495" ; 
	affx:commonToAll "1" .

:Gene3026_e8 a affx:Exon ; 
	affx:startsAt "34785481" ; 
	affx:stopsAt "34785575" ; 
	affx:commonToAll "1" .

:Gene3026_e9 a affx:Exon ; 
	affx:startsAt "34785845" ; 
	affx:stopsAt "34786298" ; 
	affx:commonToAll "1" .

:Gene3026_e10 a affx:Exon ; 
	affx:startsAt "34786581" ; 
	affx:stopsAt "34786862" ; 
	affx:commonToAll "1" .

:Gene3026_e11 a affx:Exon ; 
	affx:startsAt "34787224" ; 
	affx:stopsAt "34788756" ; 
	affx:commonToAll "1" .

:Gene3026_e12 a affx:Exon ; 
	affx:startsAt "34789216" ; 
	affx:stopsAt "34789435" ; 
	affx:commonToAll "1" .

:Gene3026_e13 a affx:Exon ; 
	affx:startsAt "34789938" ; 
	affx:stopsAt "34790075" ; 
	affx:commonToAll "1" .

:Gene3026_e14 a affx:Exon ; 
	affx:startsAt "34791843" ; 
	affx:stopsAt "34791908" ; 
	affx:commonToAll "1" .

:Gene3026_e15 a affx:Exon ; 
	affx:startsAt "34792022" ; 
	affx:stopsAt "34792103" ; 
	affx:commonToAll "1" .

:Gene3026_e16 a affx:Exon ; 
	affx:startsAt "34793254" ; 
	affx:stopsAt "34793377" ; 
	affx:commonToAll "1" .

:Gene3026_e17 a affx:Exon ; 
	affx:startsAt "34793554" ; 
	affx:stopsAt "34793604" ; 
	affx:commonToAll "1" .

:Gene3026_e18 a affx:Exon ; 
	affx:startsAt "34795471" ; 
	affx:stopsAt "34795541" ; 
	affx:commonToAll "1" .

:Gene3026_e19 a affx:Exon ; 
	affx:startsAt "34802671" ; 
	affx:stopsAt "34802768" ; 
	affx:commonToAll "1" .

:Gene3027 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18605634] .

:gi18605634 a affx:Transcript ;
	affx:unigene "iMm.105326" ;
	affx:translatesTo "MGQLFSNMPKDEDKGILESSFTEYFRNYKQETKIISEETTRSIELCLKKGDIQRANSIISDALKNIDNAPINIAVTGESGAGKSSLINALREIKAEEESAAEVGVTETTMKVYSYKHPKVKNLTLWDLPGIGTKKFPPKTYLETVEFKKYDFFIIVSATRFTNHEIELAKAIRIMKKNYYFVRSKVDFDLYNEEKSKPRNFNRENTLNQIRNSYLDTFRESKIDEPQVFLISNHDLSDYDFPVLMDTLLKDLPAEKRHNFLLSLPNITEAAIQKKYNSTKQFIWLQAMKDGLLATVPVVGILKDLDKERLKRSLDYYRDLFGIDDESLMFIAKDAQVPVELLKIKLKSPYLLELEEETLGGLILNCVEKFASANGGLLAAGLYFRKTYYLQFHFLETVAEDAKVLLKEAY" ;
	affx:hasCds [affx:startsAt "60740716" ;
			affx:stopsAt "60741950" ];
	affx:hasExon [ affx:relatesToExon :Gene3027_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3027_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "60740716" ;
		affx:cdsStop "60741330" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3027_e3;
		affx:cdsType "None" ] ;
	.

:Gene3027_e1 a affx:Exon ; 
	affx:startsAt "60680186" ; 
	affx:stopsAt "60680390" ; 
	affx:commonToAll "1" .

:Gene3027_e2 a affx:Exon ; 
	affx:startsAt "60740697" ; 
	affx:stopsAt "60742223" ; 
	affx:commonToAll "1" .

:Gene3027_e3 a affx:Exon ; 
	affx:startsAt "60742499" ; 
	affx:stopsAt "60742819" ; 
	affx:commonToAll "1" .

:Gene3028 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18043934] .

:gi18043934 a affx:Transcript ;
	affx:unigene "iMm.43737" ;
	affx:translatesTo "MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGF" ;
	affx:hasCds [affx:startsAt "61858913" ;
			affx:stopsAt "61890596" ];
	affx:hasExon [ affx:relatesToExon :Gene3028_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "61858913" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3028_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3028_e3;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3028_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3028_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3028_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3028_e7;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3028_e8;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3028_e9;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3028_e10;
		affx:cdsType "Partial" ;
		affx:cdsStop "61890596" ;
		affx:frame "2"] ;
	.

:Gene3028_e1 a affx:Exon ; 
	affx:startsAt "61858744" ; 
	affx:stopsAt "61859036" ; 
	affx:commonToAll "1" .

:Gene3028_e2 a affx:Exon ; 
	affx:startsAt "61859665" ; 
	affx:stopsAt "61859772" ; 
	affx:commonToAll "1" .

:Gene3028_e3 a affx:Exon ; 
	affx:startsAt "61871426" ; 
	affx:stopsAt "61871553" ; 
	affx:commonToAll "1" .

:Gene3028_e4 a affx:Exon ; 
	affx:startsAt "61872626" ; 
	affx:stopsAt "61872725" ; 
	affx:commonToAll "1" .

:Gene3028_e5 a affx:Exon ; 
	affx:startsAt "61878572" ; 
	affx:stopsAt "61878712" ; 
	affx:commonToAll "1" .

:Gene3028_e6 a affx:Exon ; 
	affx:startsAt "61879669" ; 
	affx:stopsAt "61879748" ; 
	affx:commonToAll "1" .

:Gene3028_e7 a affx:Exon ; 
	affx:startsAt "61880340" ; 
	affx:stopsAt "61880415" ; 
	affx:commonToAll "1" .

:Gene3028_e8 a affx:Exon ; 
	affx:startsAt "61881829" ; 
	affx:stopsAt "61881936" ; 
	affx:commonToAll "1" .

:Gene3028_e9 a affx:Exon ; 
	affx:startsAt "61883501" ; 
	affx:stopsAt "61883614" ; 
	affx:commonToAll "1" .

:Gene3028_e10 a affx:Exon ; 
	affx:startsAt "61890588" ; 
	affx:stopsAt "61891462" ; 
	affx:commonToAll "1" .

:Gene3029 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18043308] .

:gi18043308 a affx:Transcript ;
	affx:unigene "iMm.213399" ;
	affx:translatesTo "MARSPGDRCALLLLVQLLAVVCLDFGNGLHLEVFSPRNEGKPFPKHTHLVRQKRAWITAPVALREGEDLSRKNPIAKIHSDLAEEKGIKITYKYTGKGITEPPFGIFVFDRNTGELNITSILDREETPYFLLTGYALDSRGNNLEKPLELRIKVLDINDNEPVFTQEVFVGSIEELSAAHTLVMKITATDADDPETLNAKVSYRIVSQEPANSHMFYLNKDTGEIYTTSFTLDREEHSSYSLTVEARDGNGQITDKPVQQAQVQIRILDVNDNIPVVENKMVTQFYSRLTIS" ;
	affx:hasCds [affx:startsAt "20665176" ;
			affx:stopsAt "20689768" ];
	affx:hasExon [ affx:relatesToExon :Gene3029_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "20665176" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3029_e2;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3029_e3;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3029_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3029_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3029_e6;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3029_e7;
		affx:cdsType "Partial" ;
		affx:cdsStop "20689768" ;
		affx:frame "0"] ;
	.

:Gene3029_e1 a affx:Exon ; 
	affx:startsAt "20665137" ; 
	affx:stopsAt "20665236" ; 
	affx:commonToAll "1" .

:Gene3029_e2 a affx:Exon ; 
	affx:startsAt "20680380" ; 
	affx:stopsAt "20680416" ; 
	affx:commonToAll "1" .

:Gene3029_e3 a affx:Exon ; 
	affx:startsAt "20681831" ; 
	affx:stopsAt "20681966" ; 
	affx:commonToAll "1" .

:Gene3029_e4 a affx:Exon ; 
	affx:startsAt "20685926" ; 
	affx:stopsAt "20686088" ; 
	affx:commonToAll "1" .

:Gene3029_e5 a affx:Exon ; 
	affx:startsAt "20686220" ; 
	affx:stopsAt "20686365" ; 
	affx:commonToAll "1" .

:Gene3029_e6 a affx:Exon ; 
	affx:startsAt "20687398" ; 
	affx:stopsAt "20687565" ; 
	affx:commonToAll "1" .

:Gene3029_e7 a affx:Exon ; 
	affx:startsAt "20689594" ; 
	affx:stopsAt "20689803" ; 
	affx:commonToAll "1" .

:Gene3030 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18043529] .

:gi18043529 a affx:Transcript ;
	affx:unigene "iMm.152528" ;
	affx:translatesTo "MKIWSSEHVFGHPWDTVIKAAMRKYPNPMNPCVVGVDVLERSVDGCGRLHSLRLLSTEWGLPGLVRAILGANRTLTYIKERSVVDPAARKMELCSTNITLTNLVSVNERLVYTPHPENPEKTVLTQEAIITVKGISLGSYLESLMATTISSNAKKGWAAIEWIIEHSESAIS" ;
	affx:hasCds [affx:startsAt "67804333" ;
			affx:stopsAt "67817412" ];
	affx:hasExon [ affx:relatesToExon :Gene3030_e1;
		affx:cdsType "Partial" ;
		affx:cdsStart "67804333" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3030_e2;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3030_e3;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3030_e4;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3030_e5;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3030_e6;
		affx:cdsType "Partial" ;
		affx:cdsStop "67817412" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3030_e7;
		affx:cdsType "None" ] ;
	.

:Gene3030_e1 a affx:Exon ; 
	affx:startsAt "67804308" ; 
	affx:stopsAt "67804365" ; 
	affx:commonToAll "1" .

:Gene3030_e2 a affx:Exon ; 
	affx:startsAt "67812265" ; 
	affx:stopsAt "67812434" ; 
	affx:commonToAll "1" .

:Gene3030_e3 a affx:Exon ; 
	affx:startsAt "67813149" ; 
	affx:stopsAt "67813239" ; 
	affx:commonToAll "1" .

:Gene3030_e4 a affx:Exon ; 
	affx:startsAt "67816203" ; 
	affx:stopsAt "67816274" ; 
	affx:commonToAll "1" .

:Gene3030_e5 a affx:Exon ; 
	affx:startsAt "67816372" ; 
	affx:stopsAt "67816475" ; 
	affx:commonToAll "1" .

:Gene3030_e6 a affx:Exon ; 
	affx:startsAt "67817358" ; 
	affx:stopsAt "67817470" ; 
	affx:commonToAll "1" .

:Gene3030_e7 a affx:Exon ; 
	affx:startsAt "67818480" ; 
	affx:stopsAt "67819178" ; 
	affx:commonToAll "1" .

:Gene3031 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr18" ;
	affx:hasVariant [affx:representedBy :gi18043542] .

:gi18043542 a affx:Transcript ;
	affx:unigene "iMm.24827" ;
	affx:translatesTo "MMYWIVFAFFTTAETLTDIILSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDLTLIRDEDALPLQGPDGRLQPGPVGLLDTIEDLGDEPALSLRSSTSQPDPRTETSEDDLGDKAPKRTKPIKKVPRAEPPASKTLKTRPKKKSSGGGDSA" ;
	affx:hasCds [affx:startsAt "35022750" ;
			affx:stopsAt "35026354" ];
	affx:hasExon [ affx:relatesToExon :Gene3031_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3031_e2;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3031_e3;
		affx:cdsType "Partial" ;
		affx:cdsStart "35022750" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3031_e4;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3031_e5;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3031_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3031_e7;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3031_e8;
		affx:cdsType "Partial" ;
		affx:cdsStop "35026354" ;
		affx:frame "2"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "0" ;
				affx:stopsAt "45" ;
				affx:spannedBy [ affx:startsAt "35022750" ;
					affx:stopsAt "35022818" ;
					affx:inFrame "0" ] ;
				affx:spannedBy [ affx:startsAt "35025136" ;
					affx:stopsAt "35025203" ;
					affx:inFrame "2" ] ;
			] ;
		] ;
	.

:Gene3031_e1 a affx:Exon ; 
	affx:startsAt "35020542" ; 
	affx:stopsAt "35020672" ; 
	affx:commonToAll "1" .

:Gene3031_e2 a affx:Exon ; 
	affx:startsAt "35022338" ; 
	affx:stopsAt "35022411" ; 
	affx:commonToAll "1" .

:Gene3031_e3 a affx:Exon ; 
	affx:startsAt "35022741" ; 
	affx:stopsAt "35022818" ; 
	affx:commonToAll "1" .

:Gene3031_e4 a affx:Exon ; 
	affx:startsAt "35025136" ; 
	affx:stopsAt "35025257" ; 
	affx:commonToAll "1" .

:Gene3031_e5 a affx:Exon ; 
	affx:startsAt "35025459" ; 
	affx:stopsAt "35025573" ; 
	affx:commonToAll "1" .

:Gene3031_e6 a affx:Exon ; 
	affx:startsAt "35025829" ; 
	affx:stopsAt "35025977" ; 
	affx:commonToAll "1" .

:Gene3031_e7 a affx:Exon ; 
	affx:startsAt "35026073" ; 
	affx:stopsAt "35026204" ; 
	affx:commonToAll "1" .

:Gene3031_e8 a affx:Exon ; 
	affx:startsAt "35026285" ; 
	affx:stopsAt "35027340" ; 
	affx:commonToAll "1" .

:Gene3032 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr19" ;
	affx:hasVariant [affx:representedBy :gi12805304] .

:gi12805304 a affx:Transcript ;
	affx:unigene "iMm.29437" ;
	affx:translatesTo "MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNTPLASRETTRLVCYDLFHWACINERAAQLPRNTAPAGYQCPSCNGPIFPPANLAGPVASALREKLATVNWARAGLGLPLIDEVISPEPEPLNSSDFSDWSSFNATTTSVQEERASTPSAPAFYSQAPRPPPSPSRPEQHTVIHMGSTEALAHAPRKVYDTRDDDRTAGIHGDCDDDKYRRRPALGWLAQLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS" ;
	affx:hasCds [affx:startsAt "4741237" ;
			affx:stopsAt "4744663" ];
	affx:hasExon [ affx:relatesToExon :Gene3032_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3032_e2;
		affx:cdsType "Partial" ;
		affx:cdsStart "4741237" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3032_e3;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3032_e4;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3032_e5;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3032_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3032_e7;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3032_e8;
		affx:cdsType "Partial" ;
		affx:cdsStop "4744663" ;
		affx:frame "1"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "1" ;
		affx:containsMotif [ affx:startsAt "265" ;
				affx:stopsAt "287" ;
				affx:spannedBy [ affx:startsAt "4744525" ;
					affx:stopsAt "4744591" ;
					affx:inFrame "1" ] ;
			] ;
		] ;
	.

:Gene3032_e1 a affx:Exon ; 
	affx:startsAt "4740799" ; 
	affx:stopsAt "4740827" ; 
	affx:commonToAll "1" .

:Gene3032_e2 a affx:Exon ; 
	affx:startsAt "4741229" ; 
	affx:stopsAt "4741339" ; 
	affx:commonToAll "1" .

:Gene3032_e3 a affx:Exon ; 
	affx:startsAt "4741630" ; 
	affx:stopsAt "4741742" ; 
	affx:commonToAll "1" .

:Gene3032_e4 a affx:Exon ; 
	affx:startsAt "4742912" ; 
	affx:stopsAt "4743106" ; 
	affx:commonToAll "1" .

:Gene3032_e5 a affx:Exon ; 
	affx:startsAt "4743219" ; 
	affx:stopsAt "4743292" ; 
	affx:commonToAll "1" .

:Gene3032_e6 a affx:Exon ; 
	affx:startsAt "4743363" ; 
	affx:stopsAt "4743510" ; 
	affx:commonToAll "1" .

:Gene3032_e7 a affx:Exon ; 
	affx:startsAt "4743726" ; 
	affx:stopsAt "4743844" ; 
	affx:commonToAll "1" .

:Gene3032_e8 a affx:Exon ; 
	affx:startsAt "4744476" ; 
	affx:stopsAt "4744929" ; 
	affx:commonToAll "1" .

:Gene3033 a affx:Gene ;
	affx:strand "+" ;
	affx:chr "chr19" ;
	affx:hasVariant [affx:representedBy :gi14919419] ;
	affx:hasVariant [affx:representedBy :gi7329157] .

:gi14919419 a affx:Transcript ;
	affx:unigene "iMm.19185" ;
	affx:translatesTo "MGSMFRSEEVALVQLLLPTGSAYNCVSQLGELGLVEFRDLNESVSAFQRRFVVDVRRCEELEKTFTFLREEVQRAGLTLAPPEGTLPAPPPRDLLRIQEETDRLAQELRDVRGNQQALRAQLHQLRLHSAVLGQSHSPPVAADHTEGPFSETTPLLPGTRGPHSDLKVNFVAGAVEPYKAAALERLLWRACRGFLIASFRETEGQLEDPVTGEPATWMTFVISYWGEQIGQKIRKITDCFHCHVFPYLEQEEARFRTLQQLQQQSQELQEVLGETDRFLSQVLGRVQQLLPPWQVQIHKMKAVYLTLNQCSVNTTHKCLIAEVWCAARDLPTVQQALQSGSSEEGVSAVAHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAMVLTENRPAVKAAQNEIWQTFFGGRYLLLLMGLFSVYTGFIYNECFSRATTIFPSGWSVAAMANQSGWSDEYLSQHSMLTLNPNITGVFLGPYPFGIDPIWSLATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHVHFGQAHRLLLETLPELIFLLGLFGYLVFLIVYKWVNVSAASASSAPSILIHFINMFLFSQNPTNHLLFHGQEVVQYVLVVLALATVPILLLGTPLYLLRQHRHRRNTQRRPAGQQDEDTDKLLASPDASTLENSWSPDEEKAGSPGDEETEFVPSEIFMHQAIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGMGREIGVAAVVLVPVFAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTFTVDSD" ;
	affx:hasCds [affx:startsAt "6919286" ;
			affx:stopsAt "6927903" ];
	affx:hasExon [ affx:relatesToExon :Gene3033_e2;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e3;
		affx:cdsType "Partial" ;
		affx:cdsStart "6919286" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e4;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e7;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e8;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e9;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e10;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e11;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e12;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e13;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e14;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e15;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e16;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e17;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e18;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e19;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e20;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e21;
		affx:cdsType "Partial" ;
		affx:cdsStop "6927903" ;
		affx:frame "1"] ;
	affx:tmHMMHit [  affx:commonToAll "1" ;
		affx:motifCount "7" ;
		affx:containsMotif [ affx:startsAt "398" ;
				affx:stopsAt "420" ;
				affx:spannedBy [ affx:startsAt "6924923" ;
					affx:stopsAt "6924989" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "441" ;
				affx:stopsAt "463" ;
				affx:spannedBy [ affx:startsAt "6925156" ;
					affx:stopsAt "6925222" ;
					affx:inFrame "1" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "505" ;
				affx:stopsAt "527" ;
				affx:spannedBy [ affx:startsAt "6925427" ;
					affx:stopsAt "6925469" ;
					affx:inFrame "0" ] ;
				affx:spannedBy [ affx:startsAt "6926140" ;
					affx:stopsAt "6926164" ;
					affx:inFrame "0" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "572" ;
				affx:stopsAt "591" ;
				affx:spannedBy [ affx:startsAt "6926375" ;
					affx:stopsAt "6926432" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "593" ;
				affx:stopsAt "615" ;
				affx:spannedBy [ affx:startsAt "6926438" ;
					affx:stopsAt "6926504" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "635" ;
				affx:stopsAt "657" ;
				affx:spannedBy [ affx:startsAt "6926862" ;
					affx:stopsAt "6926928" ;
					affx:inFrame "2" ] ;
			] ;
		affx:containsMotif [ affx:startsAt "770" ;
				affx:stopsAt "792" ;
				affx:spannedBy [ affx:startsAt "6927631" ;
					affx:stopsAt "6927697" ;
					affx:inFrame "1" ] ;
			] ;
		] ;
	.

:gi7329157 a affx:Transcript ;
	affx:unigene "iMm.19185" ;
	affx:translatesTo "MGSMFRSEEVALVQLLLPTGSAYNCVSQLGELGLVEFRDLNESVSAFQRRFVVDVRRCEELEKTFTFLREEVQRAGLTLAPPEGTLPAPPPRDLLRIQEETDRLAQELRDVRGNQQALRAQLHQLRLHSAVLGQSHSPPVAADHTEGPFSETTPLLPGTRGPHSDLKVNFVAGAVEPYKAAALERLLWRACRGFLIASFRETEGQLEDPVTGEPATWMTFVISYWGEQIGQKIRKITDCFHCHVFPYLEQEEARFRTLQQLQQQSQELQEVLGETDRFLSQVLGRVQQLLPPWQVQIHKMKAVYLTLNQCSVNTTHKCLIAEVWCAARDLPTVQQALQSGSSEEGVSAVAHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAMVLTENRPAVKAAQNEIWQTFFGGRYLLLLMGLFSVYTGFIYNECFSRATTIFPSGWSVAAMANQSGWSDEYLSQHSMLTLNPNITGVFLGPYPFGIDPIWSLATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHVHFGQAHRLLLETLPELIFLLGLFGYLVFLIVYKWVNVSAASASSAPSILIHFINMFLFSQNPTNHLLFHGQEVVQYVLVVLALATVPILLLGTPLYLLRQHRHRRNTQRRPAGQQDEDTDKLLASPDASTLENSWSPDEEKAGSPGDEETEFVPSEIFMHQAIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGMGREIGVAAVVLVPVFAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTFTVDSD" ;
	affx:hasCds [affx:startsAt "6919286" ;
			affx:stopsAt "6927903" ];
	affx:hasExon [ affx:relatesToExon :Gene3033_e1;
		affx:cdsType "None" ] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e3;
		affx:cdsType "Partial" ;
		affx:cdsStart "6919286" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e4;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e5;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e6;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e7;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e8;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e9;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e10;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e11;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e12;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e13;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e14;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e15;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e16;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e17;
		affx:cdsType "Full" ;
		affx:frame "2"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e18;
		affx:cdsType "Full" ;
		affx:frame "0"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e19;
		affx:cdsType "Full" ;
		affx:frame "1"] ;
	affx:hasExon [ affx:relatesToExon :Gene3033_e20;
		affx:cdsType "Ful