# Test data in notation3 http://www.w3.org/DesignIssues/Notation3.html # @prefix affx: . @prefix rdfs: . @prefix owl: . @prefix : <#> . affx:Gene a owl:Class ; owl:hasProperty affx:onStrand ; owl:hasProperty affx:onChr ; owl:hasProperty affx:hasVariant . affx:onStrand a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The strand on which the gene exists" . affx:onChr a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The chromosome on which the gene exists" . affx:hasVariant a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range affx:SpliceVariant ; owl:minCardinality "1" ; rdfs:comment "For associating variants to genes" . affx:SpliceVariant a owl:Class ; owl:hasProperty affx:representedBy . affx:representedBy a owl:ObjectProperty ; owl:domain affx:SpliceVariant ; owl:range affx:Transcript ; owl:minCardinality "1" ; rdfs:comment "In this data, each splice variant is represented by one transcript" . affx:Transcript a owl:Class ; owl:hasProperty affx:unigene ; owl:hasProperty affx:translatesTo ; owl:hasProperty affx:fullCds ; owl:hasProperty affx:hasExon ; owl:hasProperty affx:signalPHit ; owl:hasProperty affx:tmHMMHit ; rdfs:comment "A transcript has a CDS region, a protein translation, and exons" ; rdfs:comment "Additionally the transcript might have one or more annotations" . affx:unigene a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The Unigene ID of the transcript - and splice variant" . affx:translatesTo a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The amino acid sequence derived from the transcript" . affx:fullCds a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:GenomicCoordinates ; owl:cardinality "1" ; rdfs:comment "Start and stop coordinates of the full CDS region" . affx:hasExon a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:ExonPlusCds ; owl:minCardinality "1" ; rdfs:comment "Here, exons are defined only by their coordinates " . affx:ExonPlusCds a owl:Class ; owl:hasProperty affx:relatesToExon ; owl:hasProperty affx:cdsType ; owl:hasProperty affx:cdsStart ; owl:hasProperty affx:cdsStop ; owl:hasProperty affx:frame . affx:relatesToExon a owl:ObjectProperty ; owl:domain affx:ExonWithCds ; owl:range affx:Exon ; owl:cardinality "1" ; rdfs:comment "For associating exons with properties such as frame" . affx:Exon a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:commonToAll ; rdfs:comment "Defines the coordinates of an exon on the genome" . affx:GenomicSpan a owl:Class ; rdfs:subClassOf affx:GenomicCoordinates ; rdfs:comment "This defines a region of _ungapped_ genomic alignment" . affx:GenomicCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Start and stop, possibly with intervening gaps " ; rdfs:comment "Strand and chr will be specified at the gene level " . affx:Coordinates a owl:Class ; owl:hasProperty affx:startsAt ; owl:hasProperty affx:stopsAt . affx:startsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:stopsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:cdsType a owl:ObjectProperty ; owl:domain affx:ExonPlusCds ; owl:range rdfs:Literal ; rdfs:comment "Expected CDS types are Full, Partial, and None" . affx:commonToAll a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Shows if all the gene's variants share this object" . affx:CdsOccupancy a owl:Class ; rdfs:subClassOf rdfs:Literal . affx:cdsStart a owl:ObjectProperty ; rdfs:subClassOf affx:startsAt ; rdfs:comment "For indicating where a specific CDS region starts" . affx:cdsStop a owl:ObjectProperty ; rdfs:subClassOf affx:stopsAt ; rdfs:comment "For indicating where a specific CDS region stops" . affx:frame a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" . affx:signalPHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:SignalPeptide ; owl:cardinality "1" . affx:SignalPeptide a owl:Class ; rdfs:subClassOf affx:Annotation ; rdfs:comment "Represents a SIGNALP hit" . affx:tmHMMHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:Transmembrane ; owl:cardinality "1" . affx:Transmembrane a owl:Class ; rdfs:subClassOf affx:Annotation ; owl:hasProperty affx:helixCount ; rdfs:comment "Represents a TMHMM hit" . affx:Annotation a owl:Class ; owl:hasProperty affx:containsMotif; owl:hasProperty affx:commonToAll ; owl:hasProperty affx:motifCount . affx:containsMotif a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range affx:Motif ; owl:minCardinality "1" . affx:motifCount a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Number of motifs (eg. TM passes) in this annotation" . affx:Motif a owl:Class ; owl:hasProperty affx:hasProteinSpan . affx:hasProteinSpan a owl:ObjectProperty ; owl:domain affx:Motif ; owl:range affx:ProteinSpan . affx:ProteinCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Coordinates onto the protein sequence, possibly gapped ". affx:spannedBy a owl:ObjectProperty ; owl:domain affx:ProteinSpan ; owl:range affx:CdsSpan ; owl:minCardinality "1" . affx:ProteinSpan a owl:Class ; rdfs:subClassOf affx:ProteinCoordinates ; owl:hasProperty affx:spannedBy ; rdfs:comment "An ungapped region of the protein sequence " ; rdfs:comment "Each ProteinSpan as one or more corresponding CDS span" . affx:CdsSpan a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:inFrame ; rdfs:comment "A CDS span is a genomic span with a translation frame" ; rdfs:comment "Each CDS span describes a part of the full CDS region" . :Gene2030 a affx:Gene ; affx:strand "-" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi18204548] . :gi18204548 a affx:Transcript ; affx:unigene "iMm.44087" ; affx:translatesTo "MKRLHPALPSCLLLVLFGIWRTAPQTHASSAGLPPLSATSFLEDLMDRYGKNDSLTLTQLKSLLDHLHVGVGRDNVSQPKEGPRNLSTCFSSGDLFAAHNLSERSQIGASEFQEFCPTILQQLDSQACTSENQKSEENEQTEEGKPSAIEVWGFGFLSVSLINLASLLGVLVLPCTEKAFFSRVLTYFIALSIGTLLSNALFQLIPEAFGFNPQDNYVSKSAVVFGGFYLFFFTEKILKMLLKQKNEHHHGHNHFTSETLPSKKDQEEGVTEKLQNGDLDHMIPQHCNSELDGKAPGTDEKVIVNSMSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFSANWIFALAGGMFLYIALADMFPEMNEVCQEDEKNDSFLVPFVIQNLGLLTGFSIMLVLTMYSGQIQIG" ; affx:hasCds [affx:startsAt "61243442" ; affx:stopsAt "61255706" ]; affx:hasExon [ affx:relatesToExon :Gene2030_e1; affx:cdsType "Partial" ; affx:cdsStart "61243442" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2030_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2030_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2030_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2030_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2030_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2030_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2030_e8; affx:cdsType "Partial" ; affx:cdsStop "61255706" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2030_e9; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene2030_e10; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "28" ; affx:spannedBy [ affx:startsAt "61255622" ; affx:stopsAt "61255706" ; affx:inFrame "2" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "151" ; affx:stopsAt "173" ; affx:spannedBy [ affx:startsAt "61252542" ; affx:stopsAt "61252608" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "180" ; affx:stopsAt "202" ; affx:spannedBy [ affx:startsAt "61252455" ; affx:stopsAt "61252521" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "217" ; affx:stopsAt "234" ; affx:spannedBy [ affx:startsAt "61247671" ; affx:stopsAt "61247722" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "349" ; affx:stopsAt "371" ; affx:spannedBy [ affx:startsAt "61246559" ; affx:stopsAt "61246625" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "391" ; affx:stopsAt "413" ; affx:spannedBy [ affx:startsAt "61245510" ; affx:stopsAt "61245576" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "420" ; affx:stopsAt "442" ; affx:spannedBy [ affx:startsAt "61245426" ; affx:stopsAt "61245489" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "61243586" ; affx:stopsAt "61243589" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "457" ; affx:stopsAt "479" ; affx:spannedBy [ affx:startsAt "61243475" ; affx:stopsAt "61243541" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene2030_e1 a affx:Exon ; affx:startsAt "61243073" ; affx:stopsAt "61243589" ; affx:commonToAll "1" . :Gene2030_e2 a affx:Exon ; affx:startsAt "61245426" ; affx:stopsAt "61245611" ; affx:commonToAll "1" . :Gene2030_e3 a affx:Exon ; affx:startsAt "61246534" ; affx:stopsAt "61246742" ; affx:commonToAll "1" . :Gene2030_e4 a affx:Exon ; affx:startsAt "61246859" ; affx:stopsAt "61247048" ; affx:commonToAll "1" . :Gene2030_e5 a affx:Exon ; affx:startsAt "61247632" ; affx:stopsAt "61247752" ; affx:commonToAll "1" . :Gene2030_e6 a affx:Exon ; affx:startsAt "61252440" ; affx:stopsAt "61252610" ; affx:commonToAll "1" . :Gene2030_e7 a affx:Exon ; affx:startsAt "61253214" ; affx:stopsAt "61253401" ; affx:commonToAll "1" . :Gene2030_e8 a affx:Exon ; affx:startsAt "61255442" ; affx:stopsAt "61255721" ; affx:commonToAll "1" . :Gene2030_e9 a affx:Exon ; affx:startsAt "61268070" ; affx:stopsAt "61268168" ; affx:commonToAll "1" . :Gene2030_e10 a affx:Exon ; affx:startsAt "61288082" ; affx:stopsAt "61288221" ; affx:commonToAll "1" . :Gene2031 a affx:Gene ; affx:strand "-" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi18203965] . :gi18203965 a affx:Transcript ; affx:unigene "iMm.68971" ; affx:translatesTo "MDQEFSRRLSMSEVKDDNTAKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDTFSNDSIPLFEDSVSLAYQRVQKVDCTSLRPVLLLGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKGTERPCLPEGQGDTEAFQRAIRNSTEDRSGVQQVLHRGCPGWSPVQHLHSDPGHGQSRTK" ; affx:hasCds [affx:startsAt "19260890" ; affx:stopsAt "19269784" ]; affx:hasExon [ affx:relatesToExon :Gene2031_e1; affx:cdsType "Partial" ; affx:cdsStart "19260890" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2031_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2031_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2031_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2031_e5; affx:cdsType "Partial" ; affx:cdsStop "19269784" ; affx:frame "0"] ; . :Gene2031_e1 a affx:Exon ; affx:startsAt "19259242" ; affx:stopsAt "19260963" ; affx:commonToAll "1" . :Gene2031_e2 a affx:Exon ; affx:startsAt "19261858" ; affx:stopsAt "19261968" ; affx:commonToAll "1" . :Gene2031_e3 a affx:Exon ; affx:startsAt "19263526" ; affx:stopsAt "19263654" ; affx:commonToAll "1" . :Gene2031_e4 a affx:Exon ; affx:startsAt "19263897" ; affx:stopsAt "19264041" ; affx:commonToAll "1" . :Gene2031_e5 a affx:Exon ; affx:startsAt "19269591" ; affx:stopsAt "19269785" ; affx:commonToAll "1" . :Gene2032 a affx:Gene ; affx:strand "-" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi18044685] . :gi18044685 a affx:Transcript ; affx:unigene "iMm.51437" ; affx:translatesTo "MNLVDLWLSRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV" ; affx:hasCds [affx:startsAt "10695856" ; affx:stopsAt "10696636" ]; affx:hasExon [ affx:relatesToExon :Gene2032_e1; affx:cdsType "Partial" ; affx:cdsStart "10695856" ; affx:cdsStop "10696636" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2032_e2; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "33" ; affx:spannedBy [ affx:startsAt "10696537" ; affx:stopsAt "10696636" ; affx:inFrame "2" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "203" ; affx:stopsAt "225" ; affx:spannedBy [ affx:startsAt "10695961" ; affx:stopsAt "10696027" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene2032_e1 a affx:Exon ; affx:startsAt "10695546" ; affx:stopsAt "10696793" ; affx:commonToAll "1" . :Gene2032_e2 a affx:Exon ; affx:startsAt "10775095" ; affx:stopsAt "10775272" ; affx:commonToAll "1" . :Gene2033 a affx:Gene ; affx:strand "+" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi18044899] . :gi18044899 a affx:Transcript ; affx:unigene "iMm.33169" ; affx:translatesTo "MHPPGFRNFLLLVSSLLFIGLSAAPQSFLPSLRSLSGAPCRLSRAESERRCRAPGQPPGSALCHDRGRCECGVCICHVTEPGTYFGPLCECHEWICETYDGKTCAGHGNCDCGKCKCDVGWSGEACQYPTKCDLTKKISNQMCKNSQDVICSNAGTCHCGRCKCDNSDGHGLIYGKFCECDDRECIDDETEEVCGGHGKCYCGNCYCEAGWHGDKCEFQCDITPWESKRRCTSPDGKVCSNRGTCVCGECSCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCRAGWYGKKCEHPRNCPLSAEESTKKCQGSSDLPCSGRGRCECGRCTCYPPGDSRVYGKTCECDDRRCEDLDGVVCGGHGMCSCGRCVCEKGWFGKLCQHLRKCNMTEEQSRSLCESADGTLCSGKGSCHCGKCICSGEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGTEYP" ; affx:hasCds [affx:startsAt "114912836" ; affx:stopsAt "115196002" ]; affx:hasExon [ affx:relatesToExon :Gene2033_e1; affx:cdsType "Partial" ; affx:cdsStart "114912836" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2033_e11; affx:cdsType "Partial" ; affx:cdsStop "115196002" ; affx:frame "0"] ; . :Gene2033_e1 a affx:Exon ; affx:startsAt "114912700" ; affx:stopsAt "114912934" ; affx:commonToAll "1" . :Gene2033_e2 a affx:Exon ; affx:startsAt "114913818" ; affx:stopsAt "114914036" ; affx:commonToAll "1" . :Gene2033_e3 a affx:Exon ; affx:startsAt "115050801" ; affx:stopsAt "115050948" ; affx:commonToAll "1" . :Gene2033_e4 a affx:Exon ; affx:startsAt "115063380" ; affx:stopsAt "115063503" ; affx:commonToAll "1" . :Gene2033_e5 a affx:Exon ; affx:startsAt "115066614" ; affx:stopsAt "115066755" ; affx:commonToAll "1" . :Gene2033_e6 a affx:Exon ; affx:startsAt "115069256" ; affx:stopsAt "115069397" ; affx:commonToAll "1" . :Gene2033_e7 a affx:Exon ; affx:startsAt "115080251" ; affx:stopsAt "115080398" ; affx:commonToAll "1" . :Gene2033_e8 a affx:Exon ; affx:startsAt "115177198" ; affx:stopsAt "115177315" ; affx:commonToAll "1" . :Gene2033_e9 a affx:Exon ; affx:startsAt "115189258" ; affx:stopsAt "115189405" ; affx:commonToAll "1" . :Gene2033_e10 a affx:Exon ; affx:startsAt "115194743" ; affx:stopsAt "115194857" ; affx:commonToAll "1" . :Gene2033_e11 a affx:Exon ; affx:startsAt "115195910" ; affx:stopsAt "115196704" ; affx:commonToAll "1" . :Gene2034 a affx:Gene ; affx:strand "+" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi18044044] . :gi18044044 a affx:Transcript ; affx:unigene "iMm.213148" ; affx:translatesTo "MAHVALIPGLSRGSVGAVCTQAASWGLKASTLRHLTLASIIKSRRKTDHLERTASVLRREVMAAAKVCEITHESPSVKSLRLLVADKDFSFKAGQWVDFFIPGVSVVGGFSICSSPQRLERDRIIELAVKYADHPPAVWVHNKCTLDSEVALRVGGEFFFDPQPTDAPRNLILIAGGVGINPLLSILRHSADLHRDHADKGRSYEIGTVKLFYSAKNTSELLFKKDILDLVHEFPEKISCSFHVTKQTAQISAELKPYVTDGRITEKEIRDHISAETLFYVCGPPPMTDFFSKHLESCHVPKEHICFEKWW" ; affx:hasCds [affx:startsAt "27195794" ; affx:stopsAt "27206562" ]; affx:hasExon [ affx:relatesToExon :Gene2034_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene2034_e2; affx:cdsType "Partial" ; affx:cdsStart "27195794" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2034_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2034_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2034_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2034_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2034_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2034_e8; affx:cdsType "Partial" ; affx:cdsStop "27206562" ; affx:frame "2"] ; . :Gene2034_e1 a affx:Exon ; affx:startsAt "27190100" ; affx:stopsAt "27190204" ; affx:commonToAll "1" . :Gene2034_e2 a affx:Exon ; affx:startsAt "27195786" ; affx:stopsAt "27195910" ; affx:commonToAll "1" . :Gene2034_e3 a affx:Exon ; affx:startsAt "27196218" ; affx:stopsAt "27196282" ; affx:commonToAll "1" . :Gene2034_e4 a affx:Exon ; affx:startsAt "27199515" ; affx:stopsAt "27199622" ; affx:commonToAll "1" . :Gene2034_e5 a affx:Exon ; affx:startsAt "27200637" ; affx:stopsAt "27200779" ; affx:commonToAll "1" . :Gene2034_e6 a affx:Exon ; affx:startsAt "27203539" ; affx:stopsAt "27203782" ; affx:commonToAll "1" . :Gene2034_e7 a affx:Exon ; affx:startsAt "27205136" ; affx:stopsAt "27205245" ; affx:commonToAll "1" . :Gene2034_e8 a affx:Exon ; affx:startsAt "27206407" ; affx:stopsAt "27207353" ; affx:commonToAll "1" . :Gene2035 a affx:Gene ; affx:strand "-" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi18044065] . :gi18044065 a affx:Transcript ; affx:unigene "iMm.29044" ; affx:translatesTo "MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVSTISRTGEKGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQDILRRAARDLPIYTTSASKAIRYCEKCQLIKPDRAHHCSACDRCVLKMDHHCPWVNNCVGFTNYKFFMLFLLYSLLYCLFVAATVLEYFIKFWTNEPTVLNFPSAKFHVLFLFFVSAMFFVSVLSLFSYHCWLVGKNRTTIESFRAPMFSYGIDGNGFSLGCSKNWRQVFGDEKKYWLVPIFSSLGDGCSFPARLVGMDPEQASVANQSDYVRSIGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGVTKSGTNNHVTVEIEN" ; affx:hasCds [affx:startsAt "48971160" ; affx:stopsAt "49023745" ]; affx:hasExon [ affx:relatesToExon :Gene2035_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene2035_e2; affx:cdsType "Partial" ; affx:cdsStart "48971160" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2035_e13; affx:cdsType "Partial" ; affx:cdsStop "49023745" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "29" ; affx:spannedBy [ affx:startsAt "49023658" ; affx:stopsAt "49023745" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "52" ; affx:stopsAt "74" ; affx:spannedBy [ affx:startsAt "49007485" ; affx:stopsAt "49007551" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "171" ; affx:stopsAt "193" ; affx:spannedBy [ affx:startsAt "48990154" ; affx:stopsAt "48990220" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "213" ; affx:stopsAt "235" ; affx:spannedBy [ affx:startsAt "48980482" ; affx:stopsAt "48980548" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene2035_e1 a affx:Exon ; affx:startsAt "48969640" ; affx:stopsAt "48970177" ; affx:commonToAll "1" . :Gene2035_e2 a affx:Exon ; affx:startsAt "48971121" ; affx:stopsAt "48971198" ; affx:commonToAll "1" . :Gene2035_e3 a affx:Exon ; affx:startsAt "48972620" ; affx:stopsAt "48972736" ; affx:commonToAll "1" . :Gene2035_e4 a affx:Exon ; affx:startsAt "48974359" ; affx:stopsAt "48974449" ; affx:commonToAll "1" . :Gene2035_e5 a affx:Exon ; affx:startsAt "48976718" ; affx:stopsAt "48976845" ; affx:commonToAll "1" . :Gene2035_e6 a affx:Exon ; affx:startsAt "48980451" ; affx:stopsAt "48980593" ; affx:commonToAll "1" . :Gene2035_e7 a affx:Exon ; affx:startsAt "48990139" ; affx:stopsAt "48990260" ; affx:commonToAll "1" . :Gene2035_e8 a affx:Exon ; affx:startsAt "48991157" ; affx:stopsAt "48991190" ; affx:commonToAll "1" . :Gene2035_e9 a affx:Exon ; affx:startsAt "48992069" ; affx:stopsAt "48992139" ; affx:commonToAll "1" . :Gene2035_e10 a affx:Exon ; affx:startsAt "48999086" ; affx:stopsAt "48999207" ; affx:commonToAll "1" . :Gene2035_e11 a affx:Exon ; affx:startsAt "49007458" ; affx:stopsAt "49007562" ; affx:commonToAll "1" . :Gene2035_e12 a affx:Exon ; affx:startsAt "49011998" ; affx:stopsAt "49012025" ; affx:commonToAll "1" . :Gene2035_e13 a affx:Exon ; affx:startsAt "49023627" ; affx:stopsAt "49023844" ; affx:commonToAll "1" . :Gene2036 a affx:Gene ; affx:strand "-" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi975274] . :gi975274 a affx:Transcript ; affx:unigene "iMm.4669" ; affx:translatesTo "MWLILLLLSGLSELGGLSQSQTEGTREKLHVQVTVPEKIRSVTSNGYETQVTYNLKIEGKTYTLDLMQKPFLPPNFRVYSYDNAGIMRSLEQKFQNICYFQGYIEGYPNSMVIVSTCTGLRGFLQFGNVSYGIEPLESSSGFEHVIYQVEPEKGGALLYAEKDIDLRDSQYKIRSIKPQRIVSHYLEIHIVVEKQMFEHIGADTAIVTQKIFQLIGLANAIFAPFNLTVILSSLEFWMDENKILTTGDANKLLYRFLKWKQSYLVLRPHDMAFLLVYRNTTDYVGATYQGKMCDKNYAGGVALHPKAVTLESLAIILVQLLSLSMGLAYDDVNKCQCGVPVCVMNPEAPHSSGVRAFSNCSMEDFSKFITSQSSHCLQNQPRLQPSYKMAVCGNGEVEEDEICDCGKKGCAEMPPPCCNPDTCKLSDGSECSSGICCNSCKLKRKGEVCRLAQDECDVTEYCNGTSEVCEDFFVQNGHPCDNRKWICINGTCQSGEQQCQDLFGIDAGFGSSECFWELNSKSDISGSCGISAGGYKECPPNDRMCGKIICKYQSENILKLRSATVIYANISGHVCVSLEYPQGHNESQKMWVRDGTVCGSNKVCQNQKCVADTFLGYDCNLEKCNHHGVCNNKKNCHCDPTYLPPDCKRMKDSYPGGSIDSGNKERAEPIPVRPYIASAYRSKSPRWPFFLIIPFYVVILVLIGMLVKVYSQRMKWRMDDFSSEEQFESESESKD" ; affx:hasCds [affx:startsAt "57152156" ; affx:stopsAt "57202639" ]; affx:hasExon [ affx:relatesToExon :Gene2036_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene2036_e2; affx:cdsType "Partial" ; affx:cdsStart "57152156" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2036_e21; affx:cdsType "Full" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "18" ; affx:spannedBy [ affx:startsAt "57202585" ; affx:stopsAt "57202639" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "687" ; affx:stopsAt "709" ; affx:spannedBy [ affx:startsAt "57153814" ; affx:stopsAt "57153880" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene2036_e1 a affx:Exon ; affx:startsAt "57151461" ; affx:stopsAt "57151768" ; affx:commonToAll "1" . :Gene2036_e2 a affx:Exon ; affx:startsAt "57152131" ; affx:stopsAt "57152190" ; affx:commonToAll "1" . :Gene2036_e3 a affx:Exon ; affx:startsAt "57153767" ; affx:stopsAt "57153927" ; affx:commonToAll "1" . :Gene2036_e4 a affx:Exon ; affx:startsAt "57158904" ; affx:stopsAt "57159034" ; affx:commonToAll "1" . :Gene2036_e5 a affx:Exon ; affx:startsAt "57159329" ; affx:stopsAt "57159407" ; affx:commonToAll "1" . :Gene2036_e6 a affx:Exon ; affx:startsAt "57161664" ; affx:stopsAt "57161848" ; affx:commonToAll "1" . :Gene2036_e7 a affx:Exon ; affx:startsAt "57164380" ; affx:stopsAt "57164486" ; affx:commonToAll "1" . :Gene2036_e8 a affx:Exon ; affx:startsAt "57167230" ; affx:stopsAt "57167423" ; affx:commonToAll "1" . :Gene2036_e9 a affx:Exon ; affx:startsAt "57170317" ; affx:stopsAt "57170416" ; affx:commonToAll "1" . :Gene2036_e10 a affx:Exon ; affx:startsAt "57174791" ; affx:stopsAt "57174969" ; affx:commonToAll "1" . :Gene2036_e11 a affx:Exon ; affx:startsAt "57178151" ; affx:stopsAt "57178288" ; affx:commonToAll "1" . :Gene2036_e12 a affx:Exon ; affx:startsAt "57180837" ; affx:stopsAt "57180919" ; affx:commonToAll "1" . :Gene2036_e13 a affx:Exon ; affx:startsAt "57181937" ; affx:stopsAt "57182104" ; affx:commonToAll "1" . :Gene2036_e14 a affx:Exon ; affx:startsAt "57183118" ; affx:stopsAt "57183190" ; affx:commonToAll "1" . :Gene2036_e15 a affx:Exon ; affx:startsAt "57184237" ; affx:stopsAt "57184294" ; affx:commonToAll "1" . :Gene2036_e16 a affx:Exon ; affx:startsAt "57192880" ; affx:stopsAt "57193049" ; affx:commonToAll "1" . :Gene2036_e17 a affx:Exon ; affx:startsAt "57193557" ; affx:stopsAt "57193634" ; affx:commonToAll "1" . :Gene2036_e18 a affx:Exon ; affx:startsAt "57197881" ; affx:stopsAt "57197960" ; affx:commonToAll "1" . :Gene2036_e19 a affx:Exon ; affx:startsAt "57198966" ; affx:stopsAt "57199022" ; affx:commonToAll "1" . :Gene2036_e20 a affx:Exon ; affx:startsAt "57202127" ; affx:stopsAt "57202204" ; affx:commonToAll "1" . :Gene2036_e21 a affx:Exon ; affx:startsAt "57202566" ; affx:stopsAt "57202639" ; affx:commonToAll "1" . :DAD1 a affx:Gene ; affx:strand "-" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi849126] . :gi849126 a affx:Transcript ; affx:unigene "iMm.2547" ; affx:translatesTo "MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG" ; affx:hasCds [affx:startsAt "45333500" ; affx:stopsAt "45344606" ]; affx:hasExon [ affx:relatesToExon :DAD1_e1; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :DAD1_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "29" ; affx:stopsAt "51" ; affx:spannedBy [ affx:startsAt "45344453" ; affx:stopsAt "45344519" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "56" ; affx:stopsAt "78" ; affx:spannedBy [ affx:startsAt "45344395" ; affx:stopsAt "45344438" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "45333608" ; affx:stopsAt "45333631" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "93" ; affx:stopsAt "112" ; affx:spannedBy [ affx:startsAt "45333506" ; affx:stopsAt "45333563" ; affx:inFrame "1" ] ; ] ; ] ; . :DAD1_e1 a affx:Exon ; affx:startsAt "45333500" ; affx:stopsAt "45333631" ; affx:commonToAll "1" . :DAD1_e2 a affx:Exon ; affx:startsAt "45344395" ; affx:stopsAt "45344606" ; affx:commonToAll "1" . :GDF10 a affx:Gene ; affx:strand "+" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi18654373] . :gi18654373 a affx:Transcript ; affx:unigene "iMm.40323" ; affx:translatesTo "MAPGPARISLGSQLLPMVPLLLLLRGAGCGHRGPSWSSLPSAAAGLQGDRDSQQSPGDAAAALGPGAQDMVAIHMLRLYEKYNRRGAPPGGGNTVRSFRARLEMIDQKPVYFFNLTSMQDSEMILTAAFHFYSEPPRWPRAREVFCKPRAKNASCRLLTPGLPARLHLIFRSLSQNTATQGLLRGAMALTPPPRGLWQAKDISSIIKAARRDGELLLSAQLDTGEKDPGVPRPSSHMPYILVYANDLAISEPNSVAVSLQRYDPFPAGDFEPGAAPNSSADPRVRRAAQVSKPLQDNELPGLDERPAPALHAQNFHKHEFWSSPFRALKPRTGRKDRKKKDQDTFTAASSQVLDFDEKTMQKARRRQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIVPGIPEPCCVPDKMNSLGVLFLDENRNAVLKVYPNMSVETCACR" ; affx:hasCds [affx:startsAt "29031781" ; affx:stopsAt "29042399" ]; affx:hasExon [ affx:relatesToExon :GDF10_e1; affx:cdsType "Partial" ; affx:cdsStart "29031781" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :GDF10_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :GDF10_e3; affx:cdsType "Partial" ; affx:cdsStop "29042399" ; affx:frame "2"] ; . :GDF10_e1 a affx:Exon ; affx:startsAt "29031657" ; affx:stopsAt "29032088" ; affx:commonToAll "1" . :GDF10_e2 a affx:Exon ; affx:startsAt "29039730" ; affx:stopsAt "29040662" ; affx:commonToAll "1" . :GDF10_e3 a affx:Exon ; affx:startsAt "29042207" ; affx:stopsAt "29043163" ; affx:commonToAll "1" . :N23K a affx:Gene ; affx:strand "-" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi1262587] ; affx:hasVariant [affx:representedBy :gi1311472] . :gi1262587 a affx:Transcript ; affx:unigene "iMm.16347" ; affx:translatesTo "MKILFCDVLLLSLLSSVFSSCPRDCLTCQEKLHPAPDSFNLKTCILQCEEKVFPRPLWTVCTKVMASGSGQLSPADPELVSAALYQPKASEMQHLKRMPRVRSLVQVRDAEPGADAEPGADAEPGADDAEEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGIQVIPRTACVHSKTCRPGVRIPPSPRH" ; affx:hasCds [affx:startsAt "56508226" ; affx:stopsAt "56517694" ]; affx:hasExon [ affx:relatesToExon :N23K_e2; affx:cdsType "Partial" ; affx:cdsStart "56508226" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :N23K_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :N23K_e5; affx:cdsType "Partial" ; affx:cdsStop "56517694" ; affx:frame "2"] ; . :gi1311472 a affx:Transcript ; affx:unigene "iMm.16347" ; affx:translatesTo "MKILFCDVLLLSLLSSVFSSCPRDCLTCQEKLHPAPDSFNLKTCILQCEEKVFPRPLWTVCTKVMASGSGQLSPADPELVSAALYQPKASEMQHLKRMPRVRSLVQVRDAEPGADAEPGADAEPGADDAEEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV" ; affx:hasCds [affx:startsAt "56511199" ; affx:stopsAt "56517694" ]; affx:hasExon [ affx:relatesToExon :N23K_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :N23K_e3; affx:cdsType "Partial" ; affx:cdsStart "56511199" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :N23K_e6; affx:cdsType "Partial" ; affx:cdsStop "56517694" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :N23K_e7; affx:cdsType "None" ] ; . :N23K_e1 a affx:Exon ; affx:startsAt "56507932" ; affx:stopsAt "56508312" ; affx:commonToAll "0" . :N23K_e2 a affx:Exon ; affx:startsAt "56507935" ; affx:stopsAt "56508312" ; affx:commonToAll "0" . :N23K_e3 a affx:Exon ; affx:startsAt "56511154" ; affx:stopsAt "56511637" ; affx:commonToAll "0" . :N23K_e4 a affx:Exon ; affx:startsAt "56511210" ; affx:stopsAt "56511637" ; affx:commonToAll "0" . :N23K_e5 a affx:Exon ; affx:startsAt "56517568" ; affx:stopsAt "56517717" ; affx:commonToAll "0" . :N23K_e6 a affx:Exon ; affx:startsAt "56517568" ; affx:stopsAt "56517718" ; affx:commonToAll "0" . :N23K_e7 a affx:Exon ; affx:startsAt "56531767" ; affx:stopsAt "56532102" ; affx:commonToAll "0" . :NFL a affx:Gene ; affx:strand "+" ; affx:chr "chr14" ; affx:hasVariant [affx:representedBy :gi200037] . :gi200037 a affx:Transcript ; affx:unigene "iMm.1956" ; affx:translatesTo "MSSFGYDPYFSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADEALARAELEKRIDSLMDEIAFLKKVHEEEIAELQAQIQYAQISVEMDVSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRSTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYSGLQSSSYLMSARSFPAYYTSHVQEEQTEVEETIEATKAEEAKDEPPSEGEAEEEEKEKEEGEEEEGAEEEEAAKDESEDTKEEEEGGEGEEEDTKESEEEEKKEESAGEEQVAKKKD" ; affx:hasCds [affx:startsAt "59220493" ; affx:stopsAt "59223978" ]; affx:hasExon [ affx:relatesToExon :NFL_e1; affx:cdsType "Partial" ; affx:cdsStart "59220493" ; affx:cdsStop "59221099" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :NFL_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :NFL_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :NFL_e4; affx:cdsType "Partial" ; affx:cdsStop "59223978" ; affx:frame "0"] ; . :NFL_e1 a affx:Exon ; affx:startsAt "59220489" ; affx:stopsAt "59221540" ; affx:commonToAll "1" . :NFL_e2 a affx:Exon ; affx:startsAt "59222504" ; affx:stopsAt "59222629" ; affx:commonToAll "1" . :NFL_e3 a affx:Exon ; affx:startsAt "59223017" ; affx:stopsAt "59223337" ; affx:commonToAll "1" . :NFL_e4 a affx:Exon ; affx:startsAt "59223838" ; affx:stopsAt "59224303" ; affx:commonToAll "1" . :Gene2041 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi13542840] . :gi13542840 a affx:Transcript ; affx:unigene "iMm.29196" ; affx:translatesTo "MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAVSLSSKSGPSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPPK" ; affx:hasCds [affx:startsAt "76840541" ; affx:stopsAt "76842737" ]; affx:hasExon [ affx:relatesToExon :Gene2041_e1; affx:cdsType "Partial" ; affx:cdsStart "76840541" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2041_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2041_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2041_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2041_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2041_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2041_e7; affx:cdsType "Partial" ; affx:cdsStop "76842737" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "59" ; affx:stopsAt "81" ; affx:spannedBy [ affx:startsAt "76841327" ; affx:stopsAt "76841393" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene2041_e1 a affx:Exon ; affx:startsAt "76840519" ; affx:stopsAt "76840670" ; affx:commonToAll "1" . :Gene2041_e2 a affx:Exon ; affx:startsAt "76841279" ; affx:stopsAt "76841476" ; affx:commonToAll "1" . :Gene2041_e3 a affx:Exon ; affx:startsAt "76841559" ; affx:stopsAt "76841686" ; affx:commonToAll "1" . :Gene2041_e4 a affx:Exon ; affx:startsAt "76841789" ; affx:stopsAt "76841947" ; affx:commonToAll "1" . :Gene2041_e5 a affx:Exon ; affx:startsAt "76842030" ; affx:stopsAt "76842191" ; affx:commonToAll "1" . :Gene2041_e6 a affx:Exon ; affx:startsAt "76842454" ; affx:stopsAt "76842555" ; affx:commonToAll "1" . :Gene2041_e7 a affx:Exon ; affx:startsAt "76842632" ; affx:stopsAt "76842913" ; affx:commonToAll "1" . :Gene2042 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi13435537] . :gi13435537 a affx:Transcript ; affx:unigene "iMm.154581" ; affx:translatesTo "MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPSEYIRYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDHLVPDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRSDFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAPGKPLKCVIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQ" ; affx:hasCds [affx:startsAt "82627518" ; affx:stopsAt "82669826" ]; affx:hasExon [ affx:relatesToExon :Gene2042_e1; affx:cdsType "Partial" ; affx:cdsStart "82627518" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2042_e18; affx:cdsType "Partial" ; affx:cdsStop "82669826" ; affx:frame "2"] ; . :Gene2042_e1 a affx:Exon ; affx:startsAt "82627512" ; affx:stopsAt "82627554" ; affx:commonToAll "1" . :Gene2042_e2 a affx:Exon ; affx:startsAt "82644303" ; affx:stopsAt "82644440" ; affx:commonToAll "1" . :Gene2042_e3 a affx:Exon ; affx:startsAt "82650176" ; affx:stopsAt "82650435" ; affx:commonToAll "1" . :Gene2042_e4 a affx:Exon ; affx:startsAt "82654135" ; affx:stopsAt "82654228" ; affx:commonToAll "1" . :Gene2042_e5 a affx:Exon ; affx:startsAt "82658482" ; affx:stopsAt "82658641" ; affx:commonToAll "1" . :Gene2042_e6 a affx:Exon ; affx:startsAt "82658862" ; affx:stopsAt "82659013" ; affx:commonToAll "1" . :Gene2042_e7 a affx:Exon ; affx:startsAt "82659769" ; affx:stopsAt "82659874" ; affx:commonToAll "1" . :Gene2042_e8 a affx:Exon ; affx:startsAt "82660858" ; affx:stopsAt "82660950" ; affx:commonToAll "1" . :Gene2042_e9 a affx:Exon ; affx:startsAt "82662489" ; affx:stopsAt "82662595" ; affx:commonToAll "1" . :Gene2042_e10 a affx:Exon ; affx:startsAt "82664553" ; affx:stopsAt "82664711" ; affx:commonToAll "1" . :Gene2042_e11 a affx:Exon ; affx:startsAt "82664905" ; affx:stopsAt "82664979" ; affx:commonToAll "1" . :Gene2042_e12 a affx:Exon ; affx:startsAt "82665476" ; affx:stopsAt "82665588" ; affx:commonToAll "1" . :Gene2042_e13 a affx:Exon ; affx:startsAt "82666949" ; affx:stopsAt "82667072" ; affx:commonToAll "1" . :Gene2042_e14 a affx:Exon ; affx:startsAt "82667269" ; affx:stopsAt "82667425" ; affx:commonToAll "1" . :Gene2042_e15 a affx:Exon ; affx:startsAt "82668169" ; affx:stopsAt "82668361" ; affx:commonToAll "1" . :Gene2042_e16 a affx:Exon ; affx:startsAt "82668743" ; affx:stopsAt "82668876" ; affx:commonToAll "1" . :Gene2042_e17 a affx:Exon ; affx:startsAt "82669301" ; affx:stopsAt "82669423" ; affx:commonToAll "1" . :Gene2042_e18 a affx:Exon ; affx:startsAt "82669691" ; affx:stopsAt "82670197" ; affx:commonToAll "1" . :Cacnb3 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi6680823] . :gi6680823 a affx:Transcript ; affx:unigene "iMm.3544" ; affx:translatesTo "MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQKARRFGNPSSLGDIGNRRFPPPSIAKQKQKQAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIERSSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVLQRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERVEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHDHNDRNWQRNRPWPKDSY" ; affx:hasCds [affx:startsAt "99546922" ; affx:stopsAt "99555308" ]; affx:hasExon [ affx:relatesToExon :Cacnb3_e1; affx:cdsType "Partial" ; affx:cdsStart "99546922" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e5; affx:cdsType "Partial" ; affx:cdsStop "99552476" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Cacnb3_e13; affx:cdsType "Partial" ; affx:cdsStop "99555308" ; affx:frame "1"] ; . :Cacnb3_e1 a affx:Exon ; affx:startsAt "99546858" ; affx:stopsAt "99546967" ; affx:commonToAll "1" . :Cacnb3_e2 a affx:Exon ; affx:startsAt "99551241" ; affx:stopsAt "99551364" ; affx:commonToAll "1" . :Cacnb3_e3 a affx:Exon ; affx:startsAt "99551567" ; affx:stopsAt "99551690" ; affx:commonToAll "1" . :Cacnb3_e4 a affx:Exon ; affx:startsAt "99552092" ; affx:stopsAt "99552208" ; affx:commonToAll "1" . :Cacnb3_e5 a affx:Exon ; affx:startsAt "99552421" ; affx:stopsAt "99552487" ; affx:commonToAll "1" . :Cacnb3_e6 a affx:Exon ; affx:startsAt "99552695" ; affx:stopsAt "99552715" ; affx:commonToAll "1" . :Cacnb3_e7 a affx:Exon ; affx:startsAt "99552913" ; affx:stopsAt "99552994" ; affx:commonToAll "1" . :Cacnb3_e8 a affx:Exon ; affx:startsAt "99553136" ; affx:stopsAt "99553195" ; affx:commonToAll "1" . :Cacnb3_e9 a affx:Exon ; affx:startsAt "99553352" ; affx:stopsAt "99553462" ; affx:commonToAll "1" . :Cacnb3_e10 a affx:Exon ; affx:startsAt "99553675" ; affx:stopsAt "99553827" ; affx:commonToAll "1" . :Cacnb3_e11 a affx:Exon ; affx:startsAt "99554045" ; affx:stopsAt "99554141" ; affx:commonToAll "1" . :Cacnb3_e12 a affx:Exon ; affx:startsAt "99554238" ; affx:stopsAt "99554388" ; affx:commonToAll "1" . :Cacnb3_e13 a affx:Exon ; affx:startsAt "99554993" ; affx:stopsAt "99556266" ; affx:commonToAll "1" . :Xybp a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi6580812] . :gi6580812 a affx:Transcript ; affx:unigene "iMm.5181" ; affx:translatesTo "MQEQEISFIFKYNEGLCMNIDSDSILMSILDMSLHQQMGSDRDLQSSTSSVSLPSVKKAPKQRRISIGSLFRRKKDSKRKSRELNGGVDGIASIESIHSEMCADKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCLRQYLRIEISESRVNISCPECTERFNPHDIRLILSDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKLTCGREGCGTEFCYHCKQIWHPNQTCDAARQERAQSLRLRTIRSSSISYSQESGAAADDIKPCPRCAAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLVGAPVGIALIAGIAIPAMIIGIPVYVGRKIHNRYEGKDVSKHKRNLAIAGGVTLSVIVSPVVAAVTVGIGVPIMLAYVYGVVPISLCRSGGCGVSAGNGKGVRIEFDDENDINVGGTNAAIDTTSVAEARHNPSIGEGSVGGLTGSLSASGSHMDRIGTIRDNLSETASTMALAGASITGSLSGSAMVNCFNRLEVQADVQKERCSLSGESGTVSLGTVSDNASTKAMAGSILNSYIPLDREGNSMEVQVDIESKPFKFRHNSGSSSVDDSGATRGHTGGASSGLPEGKSSATKWSKEATGGKKSKSGKLRKKGNMKINETREDMDAQLLEQQSTNSSEFEAPSLSDSMPSVADSHSSHFSEFSCSDLESMRTSCSHGSSDCHARFTAVNTLPEVENDRLENSPHQCSSALLSKAASCSDVPQPSHAADEHGTSRSGGKPMVDLCFGDALRETNNNHSHQTADLKVAVQTEI" ; affx:hasCds [affx:startsAt "36340464" ; affx:stopsAt "36364973" ]; affx:hasExon [ affx:relatesToExon :Xybp_e1; affx:cdsType "Partial" ; affx:cdsStart "36340464" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Xybp_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Xybp_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Xybp_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Xybp_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Xybp_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Xybp_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Xybp_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Xybp_e9; affx:cdsType "Partial" ; affx:cdsStop "36364973" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "373" ; affx:stopsAt "395" ; affx:spannedBy [ affx:startsAt "36352030" ; affx:stopsAt "36352096" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "416" ; affx:stopsAt "438" ; affx:spannedBy [ affx:startsAt "36346846" ; affx:stopsAt "36346904" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "36346371" ; affx:stopsAt "36346379" ; affx:inFrame "1" ] ; ] ; ] ; . :Xybp_e1 a affx:Exon ; affx:startsAt "36339029" ; affx:stopsAt "36341161" ; affx:commonToAll "1" . :Xybp_e2 a affx:Exon ; affx:startsAt "36343182" ; affx:stopsAt "36343326" ; affx:commonToAll "1" . :Xybp_e3 a affx:Exon ; affx:startsAt "36344511" ; affx:stopsAt "36344725" ; affx:commonToAll "1" . :Xybp_e4 a affx:Exon ; affx:startsAt "36346217" ; affx:stopsAt "36346379" ; affx:commonToAll "1" . :Xybp_e5 a affx:Exon ; affx:startsAt "36346846" ; affx:stopsAt "36346961" ; affx:commonToAll "1" . :Xybp_e6 a affx:Exon ; affx:startsAt "36352024" ; affx:stopsAt "36352187" ; affx:commonToAll "1" . :Xybp_e7 a affx:Exon ; affx:startsAt "36353406" ; affx:stopsAt "36353551" ; affx:commonToAll "1" . :Xybp_e8 a affx:Exon ; affx:startsAt "36359038" ; affx:stopsAt "36359247" ; affx:commonToAll "1" . :Xybp_e9 a affx:Exon ; affx:startsAt "36364299" ; affx:stopsAt "36365040" ; affx:commonToAll "1" . :Rab3ip2-pending a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi16716606] . :gi16716606 a affx:Transcript ; affx:unigene "iMm.125521" ; affx:translatesTo "MSAPLGPRGRPAPTPAASQPPPQPEMPDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKIKEEHKAQPTQWFPFSGITELVNNVLQPQQKQPNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSGAWFYNSGSNTLQQPDQKVPRGLRNEEAPQEKKAKLHEQPQFQGAPGDLSVPAVEKGRAHGLTRQDTIKNGSGVKHQIASDMPSDRKRSPSVSRDQNRRYEQSEEREDYSQYVPSDGTMPRSPSDYADRRSQREPQFYEEPGHLNYRDSNRRGHRHSKEYIVDDEDVESRDEYERQRREEEYQARYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANAELEDSRISLLRMDRPSRQRSVSERRAAMENQRSYSMERTREAQGQSSYPQRTSNHSPPTPRRSPIPLDRPDMRRADSLRKQHHLDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPPRPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVELESESVSEKGDSQKGKRKTSEQGVLSDSNTRSERQKKRMYYGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHDVSSLPLPRPSPYLPRRQLHGESPTRRLQRSKRISDSEVSDYDCEDGVGVVSDYRHNGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDVIGRTRSWSPSAPPPQRNVEQGHRGTRATGHYNTISRMDRHRVMDDHYSSDRDRSHPRTGSVQTSPSSTPGTGRRGRQLPQLPPKGTLERSAMDIEERNRQMKLNKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADTVSTKSSDSDVSDVSAVSRTSSASRFSSTSYMSVQSERPRGNRKISVFTSKMQNRQMGVSGKNLTKSTSISGDMCSLEKNDGSQSDTAVGALGTSGKKRRSSIGAKMVAIVGLSRKSRSASQLSQTEGGGKKLRSTVQRSTETGLAVEMRNWMTRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSFEESPQGRVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSLESSTGPSYSRS" ; affx:hasCds [affx:startsAt "39378716" ; affx:stopsAt "39862834" ]; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e1; affx:cdsType "Partial" ; affx:cdsStart "39378716" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e20; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e21; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e22; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e23; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e24; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e25; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e26; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Rab3ip2-pending_e27; affx:cdsType "Partial" ; affx:cdsStop "39862834" ; affx:frame "2"] ; . :Rab3ip2-pending_e1 a affx:Exon ; affx:startsAt "39378685" ; affx:stopsAt "39378892" ; affx:commonToAll "1" . :Rab3ip2-pending_e2 a affx:Exon ; affx:startsAt "39455113" ; affx:stopsAt "39455146" ; affx:commonToAll "1" . :Rab3ip2-pending_e3 a affx:Exon ; affx:startsAt "39455551" ; affx:stopsAt "39455638" ; affx:commonToAll "1" . :Rab3ip2-pending_e4 a affx:Exon ; affx:startsAt "39472340" ; affx:stopsAt "39472551" ; affx:commonToAll "1" . :Rab3ip2-pending_e5 a affx:Exon ; affx:startsAt "39525576" ; affx:stopsAt "39525887" ; affx:commonToAll "1" . :Rab3ip2-pending_e6 a affx:Exon ; affx:startsAt "39618616" ; affx:stopsAt "39619542" ; affx:commonToAll "1" . :Rab3ip2-pending_e7 a affx:Exon ; affx:startsAt "39632960" ; affx:stopsAt "39633169" ; affx:commonToAll "1" . :Rab3ip2-pending_e8 a affx:Exon ; affx:startsAt "39635097" ; affx:stopsAt "39635217" ; affx:commonToAll "1" . :Rab3ip2-pending_e9 a affx:Exon ; affx:startsAt "39637425" ; affx:stopsAt "39637525" ; affx:commonToAll "1" . :Rab3ip2-pending_e10 a affx:Exon ; affx:startsAt "39638511" ; affx:stopsAt "39638635" ; affx:commonToAll "1" . :Rab3ip2-pending_e11 a affx:Exon ; affx:startsAt "39640336" ; affx:stopsAt "39640383" ; affx:commonToAll "1" . :Rab3ip2-pending_e12 a affx:Exon ; affx:startsAt "39643245" ; affx:stopsAt "39643358" ; affx:commonToAll "1" . :Rab3ip2-pending_e13 a affx:Exon ; affx:startsAt "39653277" ; affx:stopsAt "39653408" ; affx:commonToAll "1" . :Rab3ip2-pending_e14 a affx:Exon ; affx:startsAt "39657333" ; affx:stopsAt "39657505" ; affx:commonToAll "1" . :Rab3ip2-pending_e15 a affx:Exon ; affx:startsAt "39659510" ; affx:stopsAt "39659664" ; affx:commonToAll "1" . :Rab3ip2-pending_e16 a affx:Exon ; affx:startsAt "39687923" ; affx:stopsAt "39687992" ; affx:commonToAll "1" . :Rab3ip2-pending_e17 a affx:Exon ; affx:startsAt "39690602" ; affx:stopsAt "39690759" ; affx:commonToAll "1" . :Rab3ip2-pending_e18 a affx:Exon ; affx:startsAt "39692221" ; affx:stopsAt "39692332" ; affx:commonToAll "1" . :Rab3ip2-pending_e19 a affx:Exon ; affx:startsAt "39716829" ; affx:stopsAt "39716939" ; affx:commonToAll "1" . :Rab3ip2-pending_e20 a affx:Exon ; affx:startsAt "39747997" ; affx:stopsAt "39748098" ; affx:commonToAll "1" . :Rab3ip2-pending_e21 a affx:Exon ; affx:startsAt "39766645" ; affx:stopsAt "39766818" ; affx:commonToAll "1" . :Rab3ip2-pending_e22 a affx:Exon ; affx:startsAt "39797704" ; affx:stopsAt "39797946" ; affx:commonToAll "1" . :Rab3ip2-pending_e23 a affx:Exon ; affx:startsAt "39856009" ; affx:stopsAt "39856151" ; affx:commonToAll "1" . :Rab3ip2-pending_e24 a affx:Exon ; affx:startsAt "39860317" ; affx:stopsAt "39860430" ; affx:commonToAll "1" . :Rab3ip2-pending_e25 a affx:Exon ; affx:startsAt "39860699" ; affx:stopsAt "39860801" ; affx:commonToAll "1" . :Rab3ip2-pending_e26 a affx:Exon ; affx:startsAt "39862058" ; affx:stopsAt "39862198" ; affx:commonToAll "1" . :Rab3ip2-pending_e27 a affx:Exon ; affx:startsAt "39862615" ; affx:stopsAt "39863010" ; affx:commonToAll "1" . :Hrnbp2 a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi18461362] . :gi18461362 a affx:Transcript ; affx:unigene "iMm.25496" ; affx:translatesTo "MEKKKMVTQGNQEPTTTLDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTSEHNLTLYGSTQPHGEQSSNSPSNQNGSLTQTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLGNEAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY" ; affx:hasCds [affx:startsAt "77584074" ; affx:stopsAt "77654541" ]; affx:hasExon [ affx:relatesToExon :Hrnbp2_e1; affx:cdsType "Partial" ; affx:cdsStart "77584074" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hrnbp2_e13; affx:cdsType "Partial" ; affx:cdsStop "77654541" ; affx:frame "2"] ; . :Hrnbp2_e1 a affx:Exon ; affx:startsAt "77583716" ; affx:stopsAt "77584119" ; affx:commonToAll "1" . :Hrnbp2_e2 a affx:Exon ; affx:startsAt "77585490" ; affx:stopsAt "77585563" ; affx:commonToAll "1" . :Hrnbp2_e3 a affx:Exon ; affx:startsAt "77585979" ; affx:stopsAt "77586068" ; affx:commonToAll "1" . :Hrnbp2_e4 a affx:Exon ; affx:startsAt "77594364" ; affx:stopsAt "77594404" ; affx:commonToAll "1" . :Hrnbp2_e5 a affx:Exon ; affx:startsAt "77597853" ; affx:stopsAt "77597986" ; affx:commonToAll "1" . :Hrnbp2_e6 a affx:Exon ; affx:startsAt "77599153" ; affx:stopsAt "77599246" ; affx:commonToAll "1" . :Hrnbp2_e7 a affx:Exon ; affx:startsAt "77599352" ; affx:stopsAt "77599406" ; affx:commonToAll "1" . :Hrnbp2_e8 a affx:Exon ; affx:startsAt "77602792" ; affx:stopsAt "77602853" ; affx:commonToAll "1" . :Hrnbp2_e9 a affx:Exon ; affx:startsAt "77605490" ; affx:stopsAt "77605583" ; affx:commonToAll "1" . :Hrnbp2_e10 a affx:Exon ; affx:startsAt "77613518" ; affx:stopsAt "77613572" ; affx:commonToAll "1" . :Hrnbp2_e11 a affx:Exon ; affx:startsAt "77616834" ; affx:stopsAt "77616981" ; affx:commonToAll "1" . :Hrnbp2_e12 a affx:Exon ; affx:startsAt "77632630" ; affx:stopsAt "77632855" ; affx:commonToAll "1" . :Hrnbp2_e13 a affx:Exon ; affx:startsAt "77654514" ; affx:stopsAt "77654735" ; affx:commonToAll "1" . :Tcfcp2 a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi15628024] ; affx:hasVariant [affx:representedBy :gi18381012] . :gi15628024 a affx:Transcript ; affx:unigene "iMm.154071" ; affx:translatesTo "MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDNENEILPFQYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPELNGKLVKSIFRVVFHDRRLQYTEHQQLEGWRWNRPGDRILDIDIPMSVGVIDPRANPTQLNTVEFLWDPSKRTSVFIQVHCISTEFTMRKHGGEKGVPFRVQIDTFKENGNGEYTEHLHSASCQIKVFKPKGADRKQKIDREKMEKRTPHEKEKYQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSSFSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFTNFSGADLLKLTRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQPQPQPQPQKQEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPHQISQIYKQGPTGIHVVISDEMVQNFQEEACFILDTMEAETSDSYHVILK" ; affx:hasCds [affx:startsAt "101452096" ; affx:stopsAt "101498689" ]; affx:hasExon [ affx:relatesToExon :Tcfcp2_e1; affx:cdsType "Partial" ; affx:cdsStart "101452096" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e17; affx:cdsType "Partial" ; affx:cdsStop "101498689" ; affx:frame "1"] ; . :gi18381012 a affx:Transcript ; affx:unigene "iMm.154071" ; affx:translatesTo "MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDNENEILPFQYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPELNGKLVKSIFRVVFHDRRLQYTEHQQLEGWRWNRPGDRILDIDIPMSVGVIDPRANPTQLNTVEFLWDPSKRTSVFIQVHCISTEFTMRKHGGEKGVPFRVQIDTFKENGNGEYTEHLHSASCQIKVFKPKGADRKQKIDREKMEKRTPHEKEKYQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSSFSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFTNFSDLLKLTRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQPQPQPQPQKQEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPHQISQIYKQGPTGIHVVISDEMVQNFQEEACFILDTMEAETSDSYHVILK" ; affx:hasCds [affx:startsAt "101452096" ; affx:stopsAt "101498689" ]; affx:hasExon [ affx:relatesToExon :Tcfcp2_e1; affx:cdsType "Partial" ; affx:cdsStart "101452096" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e16; affx:cdsType "Partial" ; affx:cdsStop "101498689" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tcfcp2_e18; affx:cdsType "None" ] ; . :Tcfcp2_e1 a affx:Exon ; affx:startsAt "101450486" ; affx:stopsAt "101452134" ; affx:commonToAll "1" . :Tcfcp2_e2 a affx:Exon ; affx:startsAt "101453896" ; affx:stopsAt "101453948" ; affx:commonToAll "1" . :Tcfcp2_e3 a affx:Exon ; affx:startsAt "101459387" ; affx:stopsAt "101459530" ; affx:commonToAll "1" . :Tcfcp2_e4 a affx:Exon ; affx:startsAt "101459901" ; affx:stopsAt "101460026" ; affx:commonToAll "1" . :Tcfcp2_e5 a affx:Exon ; affx:startsAt "101460773" ; affx:stopsAt "101460858" ; affx:commonToAll "0" . :Tcfcp2_e6 a affx:Exon ; affx:startsAt "101460773" ; affx:stopsAt "101460864" ; affx:commonToAll "0" . :Tcfcp2_e7 a affx:Exon ; affx:startsAt "101461721" ; affx:stopsAt "101461815" ; affx:commonToAll "1" . :Tcfcp2_e8 a affx:Exon ; affx:startsAt "101462496" ; affx:stopsAt "101462545" ; affx:commonToAll "1" . :Tcfcp2_e9 a affx:Exon ; affx:startsAt "101465642" ; affx:stopsAt "101465731" ; affx:commonToAll "1" . :Tcfcp2_e10 a affx:Exon ; affx:startsAt "101466262" ; affx:stopsAt "101466373" ; affx:commonToAll "1" . :Tcfcp2_e11 a affx:Exon ; affx:startsAt "101468255" ; affx:stopsAt "101468408" ; affx:commonToAll "1" . :Tcfcp2_e12 a affx:Exon ; affx:startsAt "101470081" ; affx:stopsAt "101470188" ; affx:commonToAll "1" . :Tcfcp2_e13 a affx:Exon ; affx:startsAt "101473259" ; affx:stopsAt "101473365" ; affx:commonToAll "1" . :Tcfcp2_e14 a affx:Exon ; affx:startsAt "101475489" ; affx:stopsAt "101475566" ; affx:commonToAll "1" . :Tcfcp2_e15 a affx:Exon ; affx:startsAt "101476007" ; affx:stopsAt "101476159" ; affx:commonToAll "1" . :Tcfcp2_e16 a affx:Exon ; affx:startsAt "101498567" ; affx:stopsAt "101498724" ; affx:commonToAll "0" . :Tcfcp2_e17 a affx:Exon ; affx:startsAt "101498567" ; affx:stopsAt "101498725" ; affx:commonToAll "0" . :Tcfcp2_e18 a affx:Exon ; affx:startsAt "101499152" ; affx:stopsAt "101499224" ; affx:commonToAll "0" . :D15Wsu59e a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi14861851] . :gi14861851 a affx:Transcript ; affx:unigene "iMm.29144" ; affx:translatesTo "MSQEKASSPSGKMDGEKPVDASEEKRKEGGKKKSKDGGGDGGRAELNPWPEYINTRLDMYNKLKAEHDSILAEKAAKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVVAKVNKVVWDLDRPLETDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQTFERLEVKKETLLEMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGISFPDPKLLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLMEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKEQFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERTVEETVRRLQQLKQTRSKQAEEEF" ; affx:hasCds [affx:startsAt "11413335" ; affx:stopsAt "11431104" ]; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e2; affx:cdsType "Partial" ; affx:cdsStart "11413335" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :D15Wsu59e_e20; affx:cdsType "Partial" ; affx:cdsStop "11431104" ; affx:frame "2"] ; . :D15Wsu59e_e1 a affx:Exon ; affx:startsAt "11412961" ; affx:stopsAt "11413038" ; affx:commonToAll "1" . :D15Wsu59e_e2 a affx:Exon ; affx:startsAt "11413138" ; affx:stopsAt "11413484" ; affx:commonToAll "1" . :D15Wsu59e_e3 a affx:Exon ; affx:startsAt "11414408" ; affx:stopsAt "11414523" ; affx:commonToAll "1" . :D15Wsu59e_e4 a affx:Exon ; affx:startsAt "11416376" ; affx:stopsAt "11416449" ; affx:commonToAll "1" . :D15Wsu59e_e5 a affx:Exon ; affx:startsAt "11416587" ; affx:stopsAt "11416692" ; affx:commonToAll "1" . :D15Wsu59e_e6 a affx:Exon ; affx:startsAt "11416796" ; affx:stopsAt "11416897" ; affx:commonToAll "1" . :D15Wsu59e_e7 a affx:Exon ; affx:startsAt "11417025" ; affx:stopsAt "11417103" ; affx:commonToAll "1" . :D15Wsu59e_e8 a affx:Exon ; affx:startsAt "11417405" ; affx:stopsAt "11417543" ; affx:commonToAll "1" . :D15Wsu59e_e9 a affx:Exon ; affx:startsAt "11417622" ; affx:stopsAt "11417785" ; affx:commonToAll "1" . :D15Wsu59e_e10 a affx:Exon ; affx:startsAt "11418900" ; affx:stopsAt "11419067" ; affx:commonToAll "1" . :D15Wsu59e_e11 a affx:Exon ; affx:startsAt "11419636" ; affx:stopsAt "11419735" ; affx:commonToAll "1" . :D15Wsu59e_e12 a affx:Exon ; affx:startsAt "11420385" ; affx:stopsAt "11420532" ; affx:commonToAll "1" . :D15Wsu59e_e13 a affx:Exon ; affx:startsAt "11421138" ; affx:stopsAt "11421217" ; affx:commonToAll "1" . :D15Wsu59e_e14 a affx:Exon ; affx:startsAt "11421294" ; affx:stopsAt "11421359" ; affx:commonToAll "1" . :D15Wsu59e_e15 a affx:Exon ; affx:startsAt "11421556" ; affx:stopsAt "11421674" ; affx:commonToAll "1" . :D15Wsu59e_e16 a affx:Exon ; affx:startsAt "11422111" ; affx:stopsAt "11422233" ; affx:commonToAll "1" . :D15Wsu59e_e17 a affx:Exon ; affx:startsAt "11422481" ; affx:stopsAt "11422605" ; affx:commonToAll "1" . :D15Wsu59e_e18 a affx:Exon ; affx:startsAt "11423548" ; affx:stopsAt "11423739" ; affx:commonToAll "1" . :D15Wsu59e_e19 a affx:Exon ; affx:startsAt "11426505" ; affx:stopsAt "11426586" ; affx:commonToAll "1" . :D15Wsu59e_e20 a affx:Exon ; affx:startsAt "11431050" ; affx:stopsAt "11431223" ; affx:commonToAll "1" . :Gpr84 a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi13507671] . :gi13507671 a affx:Transcript ; affx:unigene "iMm.160369" ; affx:translatesTo "MWNSSDANFSCYHESVLGYGYLAIIWGVAVAVTGTVGNVLTLLALAIRPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGAVFCRIFGLLLFTSNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVGSWVVGVTSFAPLWNVFVLVPVVCTCSFDRMRGRPYTTILMGIYFVLGLSSVGVFYCLIHRQVKRAARALDQYGLHQASIRSHQVAGTQEAMPGHFQELDSGVASRGPSEGISSEPVSAATTQTLEGDSSEAGGQGIRKAAQQIAERSLPEVHRKPRETAGARRATDAPSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARGRAPRVVHMVAANLTWLNSCINPVLYAAMNRQFRHAYGSILKRGPQSFRRFH" ; affx:hasCds [affx:startsAt "104287988" ; affx:stopsAt "104289288" ]; affx:hasExon [ affx:relatesToExon :Gpr84_e1; affx:cdsType "Partial" ; affx:cdsStart "104287988" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gpr84_e2; affx:cdsType "Partial" ; affx:cdsStop "104289288" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gpr84_e3; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "20" ; affx:stopsAt "42" ; affx:spannedBy [ affx:startsAt "104289053" ; affx:stopsAt "104289119" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "55" ; affx:stopsAt "77" ; affx:spannedBy [ affx:startsAt "104288948" ; affx:stopsAt "104289014" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "95" ; affx:stopsAt "117" ; affx:spannedBy [ affx:startsAt "104288828" ; affx:stopsAt "104288894" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "137" ; affx:stopsAt "159" ; affx:spannedBy [ affx:startsAt "104288702" ; affx:stopsAt "104288768" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "179" ; affx:stopsAt "201" ; affx:spannedBy [ affx:startsAt "104288576" ; affx:stopsAt "104288642" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "321" ; affx:stopsAt "340" ; affx:spannedBy [ affx:startsAt "104288159" ; affx:stopsAt "104288216" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "350" ; affx:stopsAt "372" ; affx:spannedBy [ affx:startsAt "104288063" ; affx:stopsAt "104288129" ; affx:inFrame "1" ] ; ] ; ] ; . :Gpr84_e1 a affx:Exon ; affx:startsAt "104287765" ; affx:stopsAt "104289136" ; affx:commonToAll "1" . :Gpr84_e2 a affx:Exon ; affx:startsAt "104289245" ; affx:stopsAt "104289296" ; affx:commonToAll "1" . :Gpr84_e3 a affx:Exon ; affx:startsAt "104289949" ; affx:stopsAt "104290078" ; affx:commonToAll "1" . :Mov10l1 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi13994126] ; affx:hasVariant [affx:representedBy :gi15004350] . :gi13994126 a affx:Transcript ; affx:unigene "iMm.102985" ; affx:translatesTo "MIDDLIYFSNDAVTSKVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSKNSSKGLSDSSPRVLIGCVTSMLEGAGYISQTTYFSLESVCEGFHPCKGDWVEAEYWIRPGTWSSEAISVKPLRYKRVDKVCISSLCGRNGVIEDSIFFSLDSLKLPEGYIPRRHDIVNAVVVESSQSCYIWRALCMTPVKRDATLGEAPQEPYGALLLKNKGDIEVTRMTSFGTLKEGESKSIVIWIENKGKVSRELVSCRLANWDKAHQFRFETQGRSKSCPGAAAGSVPEGENVNSLNHHREDKTDEIPESRLANSTEISPDGCACKEESREKGNTPEKQEPEPGGLIPPGEKTHIVVTCSAKNPGRCKELLLLCFSDFLIGRHLEVSVVSSEEALIAVREPFSWKKPKSSQTLVSAKTTVVVTTQKRNSRRQLPSFLPQYPIPDRLKKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIHAEIELKEYNMSRVVLKRKGDLLVLEVPGLAESRPSLYAGDKLILKSQEYNGHVIEYIGYVMEIHEEDVTLKLNPGFEQMYNFEPMDVEFTYNRTTSRRCHYALEQVIHLGVKVLFPEEIILQSPQVTGNWSLAQDTKNDGQSITNITRNDGQSMTKVTRNDSQSITNIIRNDGQSITNVTRNDGQPITKVTRNNSQSITNITRNDGQPITKNKKTVKDQTKHTTEERHVGTTDQPEKASSTAETMDEIQIPKARDKEFFNPVLNENQKLAVRRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHYALPDSRILVCAPSNSAADLVCLRLHESKVLKPAAMVRVNATCRFEETIIDAIKPYCRDGEDIWRASRFRIIITTCSSAGLFYQIGVRVGYFTHVFVDEAGQASEPECLIPLGLISDINGQIVLAGDPMQLGPVIKSRLAMAYGLNVSMLERLMSRPAYLRDENAFGACGAYNPLLVTKLVKNYRSHSALLALPSRLFYHRELEVCADPKVVTSLLGWEKLPRKGFPLIFHGVRGNEAREGRSPSWFSPAEAVQVMRYCCLLARSVSSQVSSKDIGVITPYRKQVEKIKILLRNVDLTDIKVGSVEEFQGQEYLVIVISTVRSNEDRFEDDRYFLGFLSNSKRFNVAITRPKALLIILGNPHVLVRDPCFGALLEYSVSNGVYTGCDLPPELQALQK" ; affx:hasCds [affx:startsAt "89823784" ; affx:stopsAt "89893884" ]; affx:hasExon [ affx:relatesToExon :Mov10l1_e1; affx:cdsType "Partial" ; affx:cdsStart "89823784" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e18; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e21; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e22; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e23; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e24; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e25; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e26; affx:cdsType "Partial" ; affx:cdsStop "89893884" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e27; affx:cdsType "None" ] ; . :gi15004350 a affx:Transcript ; affx:unigene "iMm.102985" ; affx:translatesTo "MTKVTRNDSQSITNIIRNDGQSITNVTRNDGQPITKVTRNNSQSITNITRNDGQPITKNKKTVKDQTKHTTEERHVGTTDQPEKASSTAETMDEIQIPKARDKEFFNPVLNENQKLAVRRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHYALPDSRILVCAPSNSAADLVCLRLHESKVLKPAAMVRVNATCRFEETIIDAIKPYCRDGEDIWRASRFRIIITTCSSAGLFYQIGVRVGYFTHVFVDEAGQASEPECLIPLGLISDINGQIVLAGDPMQLGPVIKSRLAMAYGLNVSMLERLMSRPAYLRDENAFGACGAYNPLLVTKLVKNYRSHSALLALPSRLFYHRELEVCADPKVVTSLLGWEKLPRKGFPLIFHGVRGNEAREGRSPSWFSPAEAVQVMRYCCLLARSVSSQVSSKDIGVITPYRKQVEKIKILLRNVDLTDIKVGSVEEFQGQEYLVIVISTVRSNEDRFEDDRYFLGFLSNSKRFNVAITRPKALLIILGNPHVLVRDPCFGALLEYSVSNGVYTGCDLPPELQALQK" ; affx:hasCds [affx:startsAt "89850232" ; affx:stopsAt "89893884" ]; affx:hasExon [ affx:relatesToExon :Mov10l1_e15; affx:cdsType "Partial" ; affx:cdsStart "89850232" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e20; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e21; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e22; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e24; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e25; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e26; affx:cdsType "Partial" ; affx:cdsStop "89893884" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mov10l1_e28; affx:cdsType "None" ] ; . :Mov10l1_e1 a affx:Exon ; affx:startsAt "89823768" ; affx:stopsAt "89823910" ; affx:commonToAll "0" . :Mov10l1_e2 a affx:Exon ; affx:startsAt "89826597" ; affx:stopsAt "89826760" ; affx:commonToAll "0" . :Mov10l1_e3 a affx:Exon ; affx:startsAt "89832016" ; affx:stopsAt "89832129" ; affx:commonToAll "0" . :Mov10l1_e4 a affx:Exon ; affx:startsAt "89833051" ; affx:stopsAt "89833236" ; affx:commonToAll "0" . :Mov10l1_e5 a affx:Exon ; affx:startsAt "89834266" ; affx:stopsAt "89834407" ; affx:commonToAll "0" . :Mov10l1_e6 a affx:Exon ; affx:startsAt "89834879" ; affx:stopsAt "89835106" ; affx:commonToAll "0" . :Mov10l1_e7 a affx:Exon ; affx:startsAt "89835490" ; affx:stopsAt "89835614" ; affx:commonToAll "0" . :Mov10l1_e8 a affx:Exon ; affx:startsAt "89836978" ; affx:stopsAt "89837173" ; affx:commonToAll "0" . :Mov10l1_e9 a affx:Exon ; affx:startsAt "89842129" ; affx:stopsAt "89842244" ; affx:commonToAll "0" . :Mov10l1_e10 a affx:Exon ; affx:startsAt "89843462" ; affx:stopsAt "89843640" ; affx:commonToAll "0" . :Mov10l1_e11 a affx:Exon ; affx:startsAt "89843907" ; affx:stopsAt "89843978" ; affx:commonToAll "0" . :Mov10l1_e12 a affx:Exon ; affx:startsAt "89845792" ; affx:stopsAt "89845884" ; affx:commonToAll "0" . :Mov10l1_e13 a affx:Exon ; affx:startsAt "89849573" ; affx:stopsAt "89849632" ; affx:commonToAll "0" . :Mov10l1_e14 a affx:Exon ; affx:startsAt "89850110" ; affx:stopsAt "89850406" ; affx:commonToAll "0" . :Mov10l1_e15 a affx:Exon ; affx:startsAt "89850226" ; affx:stopsAt "89850406" ; affx:commonToAll "0" . :Mov10l1_e16 a affx:Exon ; affx:startsAt "89857025" ; affx:stopsAt "89857125" ; affx:commonToAll "1" . :Mov10l1_e17 a affx:Exon ; affx:startsAt "89859136" ; affx:stopsAt "89859315" ; affx:commonToAll "1" . :Mov10l1_e18 a affx:Exon ; affx:startsAt "89860039" ; affx:stopsAt "89860186" ; affx:commonToAll "1" . :Mov10l1_e19 a affx:Exon ; affx:startsAt "89860876" ; affx:stopsAt "89860998" ; affx:commonToAll "1" . :Mov10l1_e20 a affx:Exon ; affx:startsAt "89862488" ; affx:stopsAt "89862588" ; affx:commonToAll "1" . :Mov10l1_e21 a affx:Exon ; affx:startsAt "89863542" ; affx:stopsAt "89863707" ; affx:commonToAll "1" . :Mov10l1_e22 a affx:Exon ; affx:startsAt "89865338" ; affx:stopsAt "89865512" ; affx:commonToAll "1" . :Mov10l1_e23 a affx:Exon ; affx:startsAt "89885861" ; affx:stopsAt "89886011" ; affx:commonToAll "1" . :Mov10l1_e24 a affx:Exon ; affx:startsAt "89892655" ; affx:stopsAt "89892763" ; affx:commonToAll "1" . :Mov10l1_e25 a affx:Exon ; affx:startsAt "89893504" ; affx:stopsAt "89893642" ; affx:commonToAll "1" . :Mov10l1_e26 a affx:Exon ; affx:startsAt "89893788" ; affx:stopsAt "89893908" ; affx:commonToAll "1" . :Mov10l1_e27 a affx:Exon ; affx:startsAt "89894093" ; affx:stopsAt "89894426" ; affx:commonToAll "0" . :Mov10l1_e28 a affx:Exon ; affx:startsAt "89894093" ; affx:stopsAt "89894430" ; affx:commonToAll "0" . :Gene2051 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi14582686] . :gi14582686 a affx:Transcript ; affx:unigene "iMm.197518" ; affx:translatesTo "MKMVAPWTRFYSHSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPNQYHFSGSELGGEFEFMDDANMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAITVLVYPNSIQEYIRQLPPSFPYRDDIMSVNPTCLVLIILLFIGILLTLKGYLISCVWSCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVPSTAKEPPPPYVSA" ; affx:hasCds [affx:startsAt "34342135" ; affx:stopsAt "34387809" ]; affx:hasExon [ affx:relatesToExon :Gene2051_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2051_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2051_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2051_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2051_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2051_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2051_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "48" ; affx:spannedBy [ affx:startsAt "34342135" ; affx:stopsAt "34342234" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "34362534" ; affx:stopsAt "34362579" ; affx:inFrame "1" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "72" ; affx:stopsAt "94" ; affx:spannedBy [ affx:startsAt "34376206" ; affx:stopsAt "34376272" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "101" ; affx:stopsAt "123" ; affx:spannedBy [ affx:startsAt "34377103" ; affx:stopsAt "34377169" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "155" ; affx:stopsAt "177" ; affx:spannedBy [ affx:startsAt "34380050" ; affx:stopsAt "34380092" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "34381859" ; affx:stopsAt "34381883" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene2051_e1 a affx:Exon ; affx:startsAt "34342135" ; affx:stopsAt "34342234" ; affx:commonToAll "1" . :Gene2051_e2 a affx:Exon ; affx:startsAt "34362534" ; affx:stopsAt "34362646" ; affx:commonToAll "1" . :Gene2051_e3 a affx:Exon ; affx:startsAt "34376201" ; affx:stopsAt "34376275" ; affx:commonToAll "1" . :Gene2051_e4 a affx:Exon ; affx:startsAt "34377085" ; affx:stopsAt "34377208" ; affx:commonToAll "1" . :Gene2051_e5 a affx:Exon ; affx:startsAt "34379993" ; affx:stopsAt "34380092" ; affx:commonToAll "1" . :Gene2051_e6 a affx:Exon ; affx:startsAt "34381859" ; affx:stopsAt "34381955" ; affx:commonToAll "1" . :Gene2051_e7 a affx:Exon ; affx:startsAt "34387728" ; affx:stopsAt "34387809" ; affx:commonToAll "1" . :Gene2052 a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi10998424] . :gi10998424 a affx:Transcript ; affx:unigene "iMm.26786" ; affx:translatesTo "MKSLKAKFRKSDTNEWNKNDDRLLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVECLKVMVTHGVDVTAQDSSGHSALHVAAKNGHPECIRKLLQYKSPAENIDNSGKTALHYAAAQGCLQAVQLLCEHKSPINLKDLDGNIPLLVAVQNGHSEACHFLLDHGADVNSRDKNGRTALMLACETGSSNTVDALIKKGADLSLVDSLGHNALHYSKLSENAGIQNLLLSKISQDADLKTPTKPKQHDQVSKISSERSGTPKKRKAPPPPISPTQLSDVSSPRSITSTPLSGKESVFFAEAPFKAEISSIQENKDRLSDSTAGADSLLDISSEADQQDLLVLLQAKVASLTLHNKELQDKLQAKSPKDKEAEADLSFQSFHSTQTDLAPSPGKASDIPSSDAKSSPPVEHPAGTSTTDNDVIIRQLQDSLHDLQKRLESSEAEKKQLQDELQSQRTDTLCLNNTEISENGSDLSQKLKETQSKYEEAMKEVLSVQKQMKLGLLSQESADGYSHLREAPADEDIDTLKQDLQKAVEESARNKERVRELETKLAEKEQAEATKPPAEACEELRSSYCSVIENMNKEKAFLFEKYQQAQEEIMKLKDTLKSQMPQEAPDDSGDMKEAMNRMIDELNKQVSELSQLYREAQAELEDYRKRKSLEDAAEYIHKAEHERLMHVSNLSRAKSEEALSEMKSQYSKVLNELTQLKQLVDAHKENSVSITEHLQVITTLRTTAKEMEEKISALTGHLANKEAEVAKLEKQLAEEKAAVSDAMVPKSSYEKLQASLESEVNALATKLKESVREREKAHSEVAQVRSEVSQARREKDNIQTLLKAKEQEVTALVQKFQRAQEELAGMRRCSETSSKLEEDKDEKINEMTREVLKLKEALNSLSQLSYSTSSSKRQSQQLDLLQQQVKQLQNQLAECKKHHQEVISVYRMHLLYAVQGQMDEDVQKVLKQILTMCKNQSQKK" ; affx:hasCds [affx:startsAt "10594861" ; affx:stopsAt "10717275" ]; affx:hasExon [ affx:relatesToExon :Gene2052_e1; affx:cdsType "Partial" ; affx:cdsStart "10594861" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e17; affx:cdsType "Partial" ; affx:cdsStop "10717275" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2052_e18; affx:cdsType "None" ] ; . :Gene2052_e1 a affx:Exon ; affx:startsAt "10593143" ; affx:stopsAt "10594939" ; affx:commonToAll "1" . :Gene2052_e2 a affx:Exon ; affx:startsAt "10595658" ; affx:stopsAt "10595724" ; affx:commonToAll "1" . :Gene2052_e3 a affx:Exon ; affx:startsAt "10596495" ; affx:stopsAt "10596645" ; affx:commonToAll "1" . :Gene2052_e4 a affx:Exon ; affx:startsAt "10598476" ; affx:stopsAt "10600009" ; affx:commonToAll "1" . :Gene2052_e5 a affx:Exon ; affx:startsAt "10602532" ; affx:stopsAt "10602651" ; affx:commonToAll "1" . :Gene2052_e6 a affx:Exon ; affx:startsAt "10607192" ; affx:stopsAt "10607247" ; affx:commonToAll "1" . :Gene2052_e7 a affx:Exon ; affx:startsAt "10611248" ; affx:stopsAt "10611335" ; affx:commonToAll "1" . :Gene2052_e8 a affx:Exon ; affx:startsAt "10612669" ; affx:stopsAt "10612756" ; affx:commonToAll "1" . :Gene2052_e9 a affx:Exon ; affx:startsAt "10614313" ; affx:stopsAt "10614342" ; affx:commonToAll "1" . :Gene2052_e10 a affx:Exon ; affx:startsAt "10614798" ; affx:stopsAt "10614977" ; affx:commonToAll "1" . :Gene2052_e11 a affx:Exon ; affx:startsAt "10615726" ; affx:stopsAt "10615833" ; affx:commonToAll "1" . :Gene2052_e12 a affx:Exon ; affx:startsAt "10617712" ; affx:stopsAt "10617783" ; affx:commonToAll "1" . :Gene2052_e13 a affx:Exon ; affx:startsAt "10618561" ; affx:stopsAt "10618619" ; affx:commonToAll "1" . :Gene2052_e14 a affx:Exon ; affx:startsAt "10622446" ; affx:stopsAt "10622511" ; affx:commonToAll "1" . :Gene2052_e15 a affx:Exon ; affx:startsAt "10632731" ; affx:stopsAt "10632820" ; affx:commonToAll "1" . :Gene2052_e16 a affx:Exon ; affx:startsAt "10655863" ; affx:stopsAt "10655994" ; affx:commonToAll "1" . :Gene2052_e17 a affx:Exon ; affx:startsAt "10717239" ; affx:stopsAt "10717321" ; affx:commonToAll "1" . :Gene2052_e18 a affx:Exon ; affx:startsAt "10740469" ; affx:stopsAt "10740643" ; affx:commonToAll "1" . :Osr2 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi15418955] ; affx:hasVariant [affx:representedBy :gi15778245] . :gi15418955 a affx:Transcript ; affx:unigene "iMm.46336" ; affx:translatesTo "MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPAAVDHLQGLYGLSAVQTMHMNHWTLGYPSVHEITRSTITEMAAAQGLVDARFPFPSLPFATHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLNPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLRRHSLTHTPRQNF" ; affx:hasCds [affx:startsAt "35400470" ; affx:stopsAt "35403090" ]; affx:hasExon [ affx:relatesToExon :Osr2_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Osr2_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Osr2_e5; affx:cdsType "Partial" ; affx:cdsStop "35403090" ; affx:frame "2"] ; . :gi15778245 a affx:Transcript ; affx:unigene "iMm.46336" ; affx:translatesTo "MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPAAVDHLQGLYGLSAVQTMHMNHWTLGYPSVHEITRSTITEMAAAQGLVDARFPFPSLPFATHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLNPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQTSSPTAASSAAKCSGETAICGGTA" ; affx:hasCds [affx:startsAt "35400470" ; affx:stopsAt "35403064" ]; affx:hasExon [ affx:relatesToExon :Osr2_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Osr2_e2; affx:cdsType "Partial" ; affx:cdsStart "35400470" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Osr2_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Osr2_e6; affx:cdsType "Partial" ; affx:cdsStop "35403064" ; affx:frame "2"] ; . :Osr2_e1 a affx:Exon ; affx:startsAt "35396281" ; affx:stopsAt "35396637" ; affx:commonToAll "0" . :Osr2_e2 a affx:Exon ; affx:startsAt "35400359" ; affx:stopsAt "35401126" ; affx:commonToAll "0" . :Osr2_e3 a affx:Exon ; affx:startsAt "35400470" ; affx:stopsAt "35401126" ; affx:commonToAll "0" . :Osr2_e4 a affx:Exon ; affx:startsAt "35402082" ; affx:stopsAt "35402182" ; affx:commonToAll "1" . :Osr2_e5 a affx:Exon ; affx:startsAt "35402907" ; affx:stopsAt "35403114" ; affx:commonToAll "0" . :Osr2_e6 a affx:Exon ; affx:startsAt "35402989" ; affx:stopsAt "35403476" ; affx:commonToAll "0" . :Gene2054 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi309441] . :gi309441 a affx:Transcript ; affx:unigene "iMm.1508" ; affx:translatesTo "MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE" ; affx:hasCds [affx:startsAt "84365768" ; affx:stopsAt "84368313" ]; affx:hasExon [ affx:relatesToExon :Gene2054_e1; affx:cdsType "Partial" ; affx:cdsStart "84365768" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2054_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2054_e3; affx:cdsType "Partial" ; affx:cdsStop "84368313" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "19" ; affx:spannedBy [ affx:startsAt "84365768" ; affx:stopsAt "84365825" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "4" ; affx:containsMotif [ affx:startsAt "46" ; affx:stopsAt "68" ; affx:spannedBy [ affx:startsAt "84365906" ; affx:stopsAt "84365950" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "84366554" ; affx:stopsAt "84366576" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "78" ; affx:stopsAt "100" ; affx:spannedBy [ affx:startsAt "84366606" ; affx:stopsAt "84366672" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "107" ; affx:stopsAt "126" ; affx:spannedBy [ affx:startsAt "84368124" ; affx:stopsAt "84368181" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "136" ; affx:stopsAt "155" ; affx:spannedBy [ affx:startsAt "84368211" ; affx:stopsAt "84368268" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene2054_e1 a affx:Exon ; affx:startsAt "84365745" ; affx:stopsAt "84365950" ; affx:commonToAll "1" . :Gene2054_e2 a affx:Exon ; affx:startsAt "84366554" ; affx:stopsAt "84366693" ; affx:commonToAll "1" . :Gene2054_e3 a affx:Exon ; affx:startsAt "84368124" ; affx:stopsAt "84368398" ; affx:commonToAll "1" . :Gene2055 a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi1679771] . :gi1679771 a affx:Transcript ; affx:unigene "iMm.4283" ; affx:translatesTo "MAGACGKPHMSPASLPGKRRLEPDQELQIQEPPLLSDPDSSLSDSEESVFSGLEDLGSDSSEEDTEGVAGSSGDEDNHRAEETSEELAQAAPLCSRTEEAGALAQDEYEEDSSDEEDIRNTVGNVPLAWYDEFPHVGYDLDGKRIYKPLRTRDELDQFLDKMDDPDFWRTVQDKMTGRDLRLTDEQVALVHRLQRGQFGDSGFNPYEPAVDFFSGDIMIHPVTNRPADKRSFIPSLVEKEKVSRMVHAIKMGWIKPRRPHDPTPSFYDLWAQEDPNAVLGRHKMHVPAPKLALPGHAESYNPPPEYLPTEEERSAWMQQEPVERKLNFLPQKFPSLRTVPAYSRFIQERFERCLDLYLCPRQRKMRVNVDPEDLIPKLPRPRDLQPFPVCQALVYRGHSDLVRCLSVSPGGQWLASGSDDGTLKLWEVATARCMKTVHVGGVVRSIAWNPNPTICLVAAAMDDAVLLLNPALGDRLLVGSTDQLLEAFTPPEEPALQPARWLEVSEEEHQRGLRLRICHSKPVTQVTWHGRGDYLAVVLSSQEHTQVLLHQVSRRRSQSPFRRSHGQVQCVAFHPSRPFLLVASQRSIRIYHLLRQELTKKLMPNCKWVSSMAVHPAGDNIICGSYDSKLVWFDLDLSTKPYKVLRHHKKALRAVAFHPRYPLFASGSDDGSVIVCHGMVYNDLLQNPLLVPVKVLKGHTLTRDLGVLDVAFHPTQPWVFSSGADGTIRLFS" ; affx:hasCds [affx:startsAt "76951580" ; affx:stopsAt "76975632" ]; affx:hasExon [ affx:relatesToExon :Gene2055_e1; affx:cdsType "Partial" ; affx:cdsStart "76951580" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2055_e16; affx:cdsType "Partial" ; affx:cdsStop "76975632" ; affx:frame "2"] ; . :Gene2055_e1 a affx:Exon ; affx:startsAt "76951351" ; affx:stopsAt "76951734" ; affx:commonToAll "1" . :Gene2055_e2 a affx:Exon ; affx:startsAt "76951818" ; affx:stopsAt "76951926" ; affx:commonToAll "1" . :Gene2055_e3 a affx:Exon ; affx:startsAt "76952055" ; affx:stopsAt "76952140" ; affx:commonToAll "1" . :Gene2055_e4 a affx:Exon ; affx:startsAt "76952228" ; affx:stopsAt "76952517" ; affx:commonToAll "1" . :Gene2055_e5 a affx:Exon ; affx:startsAt "76952589" ; affx:stopsAt "76952770" ; affx:commonToAll "1" . :Gene2055_e6 a affx:Exon ; affx:startsAt "76952863" ; affx:stopsAt "76952996" ; affx:commonToAll "1" . :Gene2055_e7 a affx:Exon ; affx:startsAt "76953084" ; affx:stopsAt "76953154" ; affx:commonToAll "1" . :Gene2055_e8 a affx:Exon ; affx:startsAt "76953228" ; affx:stopsAt "76953309" ; affx:commonToAll "1" . :Gene2055_e9 a affx:Exon ; affx:startsAt "76953380" ; affx:stopsAt "76953542" ; affx:commonToAll "1" . :Gene2055_e10 a affx:Exon ; affx:startsAt "76953618" ; affx:stopsAt "76953831" ; affx:commonToAll "1" . :Gene2055_e11 a affx:Exon ; affx:startsAt "76953906" ; affx:stopsAt "76954008" ; affx:commonToAll "1" . :Gene2055_e12 a affx:Exon ; affx:startsAt "76954091" ; affx:stopsAt "76954209" ; affx:commonToAll "1" . :Gene2055_e13 a affx:Exon ; affx:startsAt "76954281" ; affx:stopsAt "76954436" ; affx:commonToAll "1" . :Gene2055_e14 a affx:Exon ; affx:startsAt "76965096" ; affx:stopsAt "76965177" ; affx:commonToAll "1" . :Gene2055_e15 a affx:Exon ; affx:startsAt "76973073" ; affx:stopsAt "76973247" ; affx:commonToAll "1" . :Gene2055_e16 a affx:Exon ; affx:startsAt "76975539" ; affx:stopsAt "76975680" ; affx:commonToAll "1" . :Gene2056 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi15679967] ; affx:hasVariant [affx:representedBy :gi15929281] . :gi15679967 a affx:Transcript ; affx:unigene "iMm.4839" ; affx:translatesTo "MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPLILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLILKASEQADSMLGDFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWAFGLVLWEIARRTIINGIVEDYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKLSHNPEKPKVIH" ; affx:hasCds [affx:startsAt "102091341" ; affx:stopsAt "102100139" ]; affx:hasExon [ affx:relatesToExon :Gene2056_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene2056_e3; affx:cdsType "Partial" ; affx:cdsStart "102091341" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e12; affx:cdsType "Partial" ; affx:cdsStop "102100139" ; affx:frame "2"] ; . :gi15929281 a affx:Transcript ; affx:unigene "iMm.4839" ; affx:translatesTo "MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPLILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLILKASEQADSMLGDFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWAFGLVLWEIARRTIINGIVEDYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKLSHNPEKPKVIH" ; affx:hasCds [affx:startsAt "102091341" ; affx:stopsAt "102100139" ]; affx:hasExon [ affx:relatesToExon :Gene2056_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene2056_e4; affx:cdsType "Partial" ; affx:cdsStart "102091341" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2056_e13; affx:cdsType "Partial" ; affx:cdsStop "102100139" ; affx:frame "2"] ; . :Gene2056_e1 a affx:Exon ; affx:startsAt "102085585" ; affx:stopsAt "102085725" ; affx:commonToAll "0" . :Gene2056_e2 a affx:Exon ; affx:startsAt "102085587" ; affx:stopsAt "102085725" ; affx:commonToAll "0" . :Gene2056_e3 a affx:Exon ; affx:startsAt "102091306" ; affx:stopsAt "102091405" ; affx:commonToAll "0" . :Gene2056_e4 a affx:Exon ; affx:startsAt "102091337" ; affx:stopsAt "102091405" ; affx:commonToAll "0" . :Gene2056_e5 a affx:Exon ; affx:startsAt "102091959" ; affx:stopsAt "102092205" ; affx:commonToAll "1" . :Gene2056_e6 a affx:Exon ; affx:startsAt "102092410" ; affx:stopsAt "102092622" ; affx:commonToAll "1" . :Gene2056_e7 a affx:Exon ; affx:startsAt "102092789" ; affx:stopsAt "102092889" ; affx:commonToAll "1" . :Gene2056_e8 a affx:Exon ; affx:startsAt "102093645" ; affx:stopsAt "102093792" ; affx:commonToAll "1" . :Gene2056_e9 a affx:Exon ; affx:startsAt "102094025" ; affx:stopsAt "102094301" ; affx:commonToAll "1" . :Gene2056_e10 a affx:Exon ; affx:startsAt "102094869" ; affx:stopsAt "102095067" ; affx:commonToAll "1" . :Gene2056_e11 a affx:Exon ; affx:startsAt "102097728" ; affx:stopsAt "102097859" ; affx:commonToAll "1" . :Gene2056_e12 a affx:Exon ; affx:startsAt "102100004" ; affx:stopsAt "102100300" ; affx:commonToAll "0" . :Gene2056_e13 a affx:Exon ; affx:startsAt "102100004" ; affx:stopsAt "102100302" ; affx:commonToAll "0" . :Gene2057 a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi17160972] . :gi17160972 a affx:Transcript ; affx:unigene "iMm.14099" ; affx:translatesTo "MQPPMDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNVCQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPSVRESGDPAPAGSIPPSGDGVAPRPVSMENGLGPAPGSPEKQPGSPSPPSVPESGQGVTKGEGGTSVPASLPGGSKEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGTKHKTILEARSGLGPIKAYPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQLKQHISSRRHRDGVAGKPNPLLSRHKKPRGAAELAGTLTFSKELPKSLAGGLLPSPLAVAAVMAAAAGSPLSLRPAPAAPLLQGPPITHPLLHPAPGPIRTAHGPILFSPY" ; affx:hasCds [affx:startsAt "104294633" ; affx:stopsAt "104312619" ]; affx:hasExon [ affx:relatesToExon :Gene2057_e1; affx:cdsType "Partial" ; affx:cdsStart "104294633" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2057_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2057_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2057_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2057_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2057_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2057_e7; affx:cdsType "Partial" ; affx:cdsStop "104312619" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2057_e8; affx:cdsType "None" ] ; . :Gene2057_e1 a affx:Exon ; affx:startsAt "104293533" ; affx:stopsAt "104294864" ; affx:commonToAll "1" . :Gene2057_e2 a affx:Exon ; affx:startsAt "104294999" ; affx:stopsAt "104295095" ; affx:commonToAll "1" . :Gene2057_e3 a affx:Exon ; affx:startsAt "104295265" ; affx:stopsAt "104295435" ; affx:commonToAll "1" . :Gene2057_e4 a affx:Exon ; affx:startsAt "104295520" ; affx:stopsAt "104295763" ; affx:commonToAll "1" . :Gene2057_e5 a affx:Exon ; affx:startsAt "104297587" ; affx:stopsAt "104297750" ; affx:commonToAll "1" . :Gene2057_e6 a affx:Exon ; affx:startsAt "104299928" ; affx:stopsAt "104300039" ; affx:commonToAll "1" . :Gene2057_e7 a affx:Exon ; affx:startsAt "104312532" ; affx:stopsAt "104312669" ; affx:commonToAll "1" . :Gene2057_e8 a affx:Exon ; affx:startsAt "104313698" ; affx:stopsAt "104313795" ; affx:commonToAll "1" . :Gene2058 a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi1814374] . :gi1814374 a affx:Transcript ; affx:unigene "iMm.1425" ; affx:translatesTo "MELSDVHCLSGSEELYTIQPTPPAGDDGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGGGVSRKASNPAGSGPNHHAPQLSSDSVLPLYSLGPGERAHNTGGTKVFPERSGSGSASGSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDNTSHTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTSLLQVTLQVLIPRLAVFSINQVLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLCLPEDIVKESVSCSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAFIVLLFITAIQSLLPSSRLMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINETYLARNVIIFASILINFLGAVLNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLSYDNLNHSGEDFLGTKEASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSLNRQRQKQLLNENSNSGIIKSHYNRRTLLTPSGPEPGAQAEGTDKSDLP" ; affx:hasCds [affx:startsAt "65142376" ; affx:stopsAt "65372663" ]; affx:hasExon [ affx:relatesToExon :Gene2058_e1; affx:cdsType "Partial" ; affx:cdsStart "65142376" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2058_e18; affx:cdsType "Partial" ; affx:cdsStop "65372663" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "9" ; affx:containsMotif [ affx:startsAt "211" ; affx:stopsAt "230" ; affx:spannedBy [ affx:startsAt "65371973" ; affx:stopsAt "65372030" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "245" ; affx:stopsAt "264" ; affx:spannedBy [ affx:startsAt "65371871" ; affx:stopsAt "65371928" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "271" ; affx:stopsAt "293" ; affx:spannedBy [ affx:startsAt "65371784" ; affx:stopsAt "65371850" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "318" ; affx:stopsAt "340" ; affx:spannedBy [ affx:startsAt "65322567" ; affx:stopsAt "65322633" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "709" ; affx:stopsAt "731" ; affx:spannedBy [ affx:startsAt "65205969" ; affx:stopsAt "65206035" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "741" ; affx:stopsAt "759" ; affx:spannedBy [ affx:startsAt "65198200" ; affx:stopsAt "65198254" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "780" ; affx:stopsAt "802" ; affx:spannedBy [ affx:startsAt "65198071" ; affx:stopsAt "65198137" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "833" ; affx:stopsAt "852" ; affx:spannedBy [ affx:startsAt "65188677" ; affx:stopsAt "65188734" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "857" ; affx:stopsAt "879" ; affx:spannedBy [ affx:startsAt "65188596" ; affx:stopsAt "65188662" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene2058_e1 a affx:Exon ; affx:startsAt "65142277" ; affx:stopsAt "65142864" ; affx:commonToAll "1" . :Gene2058_e2 a affx:Exon ; affx:startsAt "65145235" ; affx:stopsAt "65145350" ; affx:commonToAll "1" . :Gene2058_e3 a affx:Exon ; affx:startsAt "65155512" ; affx:stopsAt "65155605" ; affx:commonToAll "1" . :Gene2058_e4 a affx:Exon ; affx:startsAt "65156019" ; affx:stopsAt "65156166" ; affx:commonToAll "1" . :Gene2058_e5 a affx:Exon ; affx:startsAt "65167392" ; affx:stopsAt "65167551" ; affx:commonToAll "1" . :Gene2058_e6 a affx:Exon ; affx:startsAt "65176658" ; affx:stopsAt "65176737" ; affx:commonToAll "1" . :Gene2058_e7 a affx:Exon ; affx:startsAt "65188564" ; affx:stopsAt "65188737" ; affx:commonToAll "1" . :Gene2058_e8 a affx:Exon ; affx:startsAt "65196015" ; affx:stopsAt "65196105" ; affx:commonToAll "1" . :Gene2058_e9 a affx:Exon ; affx:startsAt "65198071" ; affx:stopsAt "65198273" ; affx:commonToAll "1" . :Gene2058_e10 a affx:Exon ; affx:startsAt "65205958" ; affx:stopsAt "65206059" ; affx:commonToAll "1" . :Gene2058_e11 a affx:Exon ; affx:startsAt "65218692" ; affx:stopsAt "65218890" ; affx:commonToAll "1" . :Gene2058_e12 a affx:Exon ; affx:startsAt "65234514" ; affx:stopsAt "65234785" ; affx:commonToAll "1" . :Gene2058_e13 a affx:Exon ; affx:startsAt "65238096" ; affx:stopsAt "65238255" ; affx:commonToAll "1" . :Gene2058_e14 a affx:Exon ; affx:startsAt "65257444" ; affx:stopsAt "65257572" ; affx:commonToAll "1" . :Gene2058_e15 a affx:Exon ; affx:startsAt "65266129" ; affx:stopsAt "65266241" ; affx:commonToAll "1" . :Gene2058_e16 a affx:Exon ; affx:startsAt "65273015" ; affx:stopsAt "65273146" ; affx:commonToAll "1" . :Gene2058_e17 a affx:Exon ; affx:startsAt "65322483" ; affx:stopsAt "65322633" ; affx:commonToAll "1" . :Gene2058_e18 a affx:Exon ; affx:startsAt "65371709" ; affx:stopsAt "65373718" ; affx:commonToAll "1" . :Biklk a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi6671637] . :gi6671637 a affx:Transcript ; affx:unigene "iMm.17912" ; affx:translatesTo "MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ" ; affx:hasCds [affx:startsAt "84335654" ; affx:stopsAt "84338580" ]; affx:hasExon [ affx:relatesToExon :Biklk_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Biklk_e2; affx:cdsType "Partial" ; affx:cdsStart "84335654" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Biklk_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Biklk_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Biklk_e5; affx:cdsType "Partial" ; affx:cdsStop "84338580" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "130" ; affx:stopsAt "149" ; affx:spannedBy [ affx:startsAt "84338517" ; affx:stopsAt "84338574" ; affx:inFrame "0" ] ; ] ; ] ; . :Biklk_e1 a affx:Exon ; affx:startsAt "84321226" ; affx:stopsAt "84321291" ; affx:commonToAll "1" . :Biklk_e2 a affx:Exon ; affx:startsAt "84335649" ; affx:stopsAt "84335797" ; affx:commonToAll "1" . :Biklk_e3 a affx:Exon ; affx:startsAt "84337419" ; affx:stopsAt "84337518" ; affx:commonToAll "1" . :Biklk_e4 a affx:Exon ; affx:startsAt "84337934" ; affx:stopsAt "84338052" ; affx:commonToAll "1" . :Biklk_e5 a affx:Exon ; affx:startsAt "84338487" ; affx:stopsAt "84338990" ; affx:commonToAll "1" . :Gene2060 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi18044921] . :gi18044921 a affx:Transcript ; affx:unigene "iMm.38151" ; affx:translatesTo "MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVHRFLEEEVRPLLKPYGNEMAVKAELCL" ; affx:hasCds [affx:startsAt "81692110" ; affx:stopsAt "81712332" ]; affx:hasExon [ affx:relatesToExon :Gene2060_e1; affx:cdsType "Partial" ; affx:cdsStart "81692110" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2060_e13; affx:cdsType "Partial" ; affx:cdsStop "81712332" ; affx:frame "0"] ; . :Gene2060_e1 a affx:Exon ; affx:startsAt "81692076" ; affx:stopsAt "81692263" ; affx:commonToAll "1" . :Gene2060_e2 a affx:Exon ; affx:startsAt "81695780" ; affx:stopsAt "81695984" ; affx:commonToAll "1" . :Gene2060_e3 a affx:Exon ; affx:startsAt "81699203" ; affx:stopsAt "81699248" ; affx:commonToAll "1" . :Gene2060_e4 a affx:Exon ; affx:startsAt "81699796" ; affx:stopsAt "81699876" ; affx:commonToAll "1" . :Gene2060_e5 a affx:Exon ; affx:startsAt "81703978" ; affx:stopsAt "81704150" ; affx:commonToAll "1" . :Gene2060_e6 a affx:Exon ; affx:startsAt "81704939" ; affx:stopsAt "81704986" ; affx:commonToAll "1" . :Gene2060_e7 a affx:Exon ; affx:startsAt "81706279" ; affx:stopsAt "81706370" ; affx:commonToAll "1" . :Gene2060_e8 a affx:Exon ; affx:startsAt "81707243" ; affx:stopsAt "81707313" ; affx:commonToAll "1" . :Gene2060_e9 a affx:Exon ; affx:startsAt "81707463" ; affx:stopsAt "81707611" ; affx:commonToAll "1" . :Gene2060_e10 a affx:Exon ; affx:startsAt "81709675" ; affx:stopsAt "81709766" ; affx:commonToAll "1" . :Gene2060_e11 a affx:Exon ; affx:startsAt "81710695" ; affx:stopsAt "81710785" ; affx:commonToAll "1" . :Gene2060_e12 a affx:Exon ; affx:startsAt "81711172" ; affx:stopsAt "81711349" ; affx:commonToAll "1" . :Gene2060_e13 a affx:Exon ; affx:startsAt "81712245" ; affx:stopsAt "81712708" ; affx:commonToAll "1" . :Gene2061 a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi16198362] . :gi16198362 a affx:Transcript ; affx:unigene "iMm.2787" ; affx:translatesTo "MVLADFGAEVVRVNRLGSTGENFLARGKRSLALDLKRSQGVTVLRRMCARADVLLEPFRCGVMEKLQLGPETLLQDNPKLIYARLSGFGQSGIFSKVAGHDINYLALSGVLSKIGRSGENPYPPLNLLADFGGGGLMCTLGIVLALFERTRSGRGQVIDSSMVEGTAYLSSFLWKTQPMGLWKQPRGQNILDGGAPFYTTYKTADGEFMAVGAIEPQFYALLLKGLGLESEELPSQMSSADWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTFEEALHHQHNRERASFITDGEQLPSPRPAPLLSRTPAVPSAKRDPSVGEHTVEVLREYGFSQEEILQLHSDRIVESDKLKANL" ; affx:hasCds [affx:startsAt "11008897" ; affx:stopsAt "11022376" ]; affx:hasExon [ affx:relatesToExon :Gene2061_e1; affx:cdsType "Partial" ; affx:cdsStart "11008897" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2061_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2061_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2061_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2061_e5; affx:cdsType "Partial" ; affx:cdsStop "11022376" ; affx:frame "0"] ; . :Gene2061_e1 a affx:Exon ; affx:startsAt "11008863" ; affx:stopsAt "11009078" ; affx:commonToAll "1" . :Gene2061_e2 a affx:Exon ; affx:startsAt "11010374" ; affx:stopsAt "11010518" ; affx:commonToAll "1" . :Gene2061_e3 a affx:Exon ; affx:startsAt "11011710" ; affx:stopsAt "11011871" ; affx:commonToAll "1" . :Gene2061_e4 a affx:Exon ; affx:startsAt "11015884" ; affx:stopsAt "11016071" ; affx:commonToAll "1" . :Gene2061_e5 a affx:Exon ; affx:startsAt "11021966" ; affx:stopsAt "11022705" ; affx:commonToAll "1" . :Gene2062 a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi1907328] . :gi1907328 a affx:Transcript ; affx:unigene "iMm.2550" ; affx:translatesTo "MTVFLSFAFFAAILTHIGCSNQRRNPENGGRRYNRIQHGQCAYTFILPEHDGNCRESATEQYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVSRQTFIIQELEKQLSRATNNNSILQKQQLELMDTVHNLISLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF" ; affx:hasCds [affx:startsAt "42612229" ; affx:stopsAt "42865868" ]; affx:hasExon [ affx:relatesToExon :Gene2062_e1; affx:cdsType "Partial" ; affx:cdsStart "42612229" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2062_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2062_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2062_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2062_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2062_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2062_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2062_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2062_e9; affx:cdsType "Partial" ; affx:cdsStop "42865868" ; affx:frame "2"] ; . :Gene2062_e1 a affx:Exon ; affx:startsAt "42612002" ; affx:stopsAt "42612390" ; affx:commonToAll "1" . :Gene2062_e2 a affx:Exon ; affx:startsAt "42623537" ; affx:stopsAt "42623668" ; affx:commonToAll "1" . :Gene2062_e3 a affx:Exon ; affx:startsAt "42644991" ; affx:stopsAt "42645158" ; affx:commonToAll "1" . :Gene2062_e4 a affx:Exon ; affx:startsAt "42653459" ; affx:stopsAt "42653561" ; affx:commonToAll "1" . :Gene2062_e5 a affx:Exon ; affx:startsAt "42661681" ; affx:stopsAt "42661809" ; affx:commonToAll "1" . :Gene2062_e6 a affx:Exon ; affx:startsAt "42681996" ; affx:stopsAt "42682229" ; affx:commonToAll "1" . :Gene2062_e7 a affx:Exon ; affx:startsAt "42698054" ; affx:stopsAt "42698176" ; affx:commonToAll "1" . :Gene2062_e8 a affx:Exon ; affx:startsAt "42709274" ; affx:stopsAt "42709430" ; affx:commonToAll "1" . :Gene2062_e9 a affx:Exon ; affx:startsAt "42865571" ; affx:stopsAt "42866174" ; affx:commonToAll "1" . :Acvr1b a affx:Gene ; affx:strand "+" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi6680629] . :gi6680629 a affx:Transcript ; affx:unigene "iMm.5070" ; affx:translatesTo "MAESAGASSFFPLVVLLLAGSGGSGPRGIQALLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPSMWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEDYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNVPNWWQSYEALRVMGKMMRECWYANGAARLTALRIKKTLSQLSVQEDVKI" ; affx:hasCds [affx:startsAt "102130305" ; affx:stopsAt "102167857" ]; affx:hasExon [ affx:relatesToExon :Acvr1b_e1; affx:cdsType "Partial" ; affx:cdsStart "102130305" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Acvr1b_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Acvr1b_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Acvr1b_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Acvr1b_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Acvr1b_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Acvr1b_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Acvr1b_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Acvr1b_e9; affx:cdsType "Partial" ; affx:cdsStop "102167857" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "24" ; affx:spannedBy [ affx:startsAt "102130305" ; affx:stopsAt "102130377" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "127" ; affx:stopsAt "149" ; affx:spannedBy [ affx:startsAt "102151228" ; affx:stopsAt "102151294" ; affx:inFrame "1" ] ; ] ; ] ; . :Acvr1b_e1 a affx:Exon ; affx:startsAt "102130296" ; affx:stopsAt "102130396" ; affx:commonToAll "1" . :Acvr1b_e2 a affx:Exon ; affx:startsAt "102150301" ; affx:stopsAt "102150541" ; affx:commonToAll "1" . :Acvr1b_e3 a affx:Exon ; affx:startsAt "102151178" ; affx:stopsAt "102151427" ; affx:commonToAll "1" . :Acvr1b_e4 a affx:Exon ; affx:startsAt "102155153" ; affx:stopsAt "102155384" ; affx:commonToAll "1" . :Acvr1b_e5 a affx:Exon ; affx:startsAt "102158959" ; affx:stopsAt "102159127" ; affx:commonToAll "1" . :Acvr1b_e6 a affx:Exon ; affx:startsAt "102159919" ; affx:stopsAt "102160076" ; affx:commonToAll "1" . :Acvr1b_e7 a affx:Exon ; affx:startsAt "102161434" ; affx:stopsAt "102161559" ; affx:commonToAll "1" . :Acvr1b_e8 a affx:Exon ; affx:startsAt "102166074" ; affx:stopsAt "102166205" ; affx:commonToAll "1" . :Acvr1b_e9 a affx:Exon ; affx:startsAt "102167731" ; affx:stopsAt "102168505" ; affx:commonToAll "1" . :Gene2064 a affx:Gene ; affx:strand "-" ; affx:chr "chr15" ; affx:hasVariant [affx:representedBy :gi10442751] ; affx:hasVariant [affx:representedBy :gi15341783] . :gi10442751 a affx:Transcript ; affx:unigene "iMm.21086" ; affx:translatesTo "MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQENGASVILRDIARARENIQKSLAGSSGPGASSGPGGDHSELIVRITSLEVENQNLRGVVQDLQQAISKLEARLSSLEKSSPTPRATAPQTQHVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKAKKPTLVAKSSILLDVKPWDDETDMAQLETCVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI" ; affx:hasCds [affx:startsAt "76393101" ; affx:stopsAt "76398799" ]; affx:hasExon [ affx:relatesToExon :Gene2064_e2; affx:cdsType "Partial" ; affx:cdsStart "76393101" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e10; affx:cdsType "Partial" ; affx:cdsStop "76398799" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e12; affx:cdsType "None" ] ; . :gi15341783 a affx:Transcript ; affx:unigene "iMm.21086" ; affx:translatesTo "MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQLKVMLPNSPEALGQATPGTSSGPGASSGPGGDHSELIVRITSLEVENQNLRGVVQDLQQAISKLEARLSSLEKSSPTPRATAPQTQHVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLRQYAEKKAKKPTLVAKSSILLDVKPWDDETDMAQLETCVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI" ; affx:hasCds [affx:startsAt "76393101" ; affx:stopsAt "76398799" ]; affx:hasExon [ affx:relatesToExon :Gene2064_e1; affx:cdsType "Partial" ; affx:cdsStart "76393101" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene2064_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene206