# Test data in notation3 http://www.w3.org/DesignIssues/Notation3.html # @prefix affx: . @prefix rdfs: . @prefix owl: . @prefix : <#> . affx:Gene a owl:Class ; owl:hasProperty affx:onStrand ; owl:hasProperty affx:onChr ; owl:hasProperty affx:hasVariant . affx:onStrand a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The strand on which the gene exists" . affx:onChr a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The chromosome on which the gene exists" . affx:hasVariant a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range affx:SpliceVariant ; owl:minCardinality "1" ; rdfs:comment "For associating variants to genes" . affx:SpliceVariant a owl:Class ; owl:hasProperty affx:representedBy . affx:representedBy a owl:ObjectProperty ; owl:domain affx:SpliceVariant ; owl:range affx:Transcript ; owl:minCardinality "1" ; rdfs:comment "In this data, each splice variant is represented by one transcript" . affx:Transcript a owl:Class ; owl:hasProperty affx:unigene ; owl:hasProperty affx:translatesTo ; owl:hasProperty affx:fullCds ; owl:hasProperty affx:hasExon ; owl:hasProperty affx:signalPHit ; owl:hasProperty affx:tmHMMHit ; rdfs:comment "A transcript has a CDS region, a protein translation, and exons" ; rdfs:comment "Additionally the transcript might have one or more annotations" . affx:unigene a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The Unigene ID of the transcript - and splice variant" . affx:translatesTo a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The amino acid sequence derived from the transcript" . affx:fullCds a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:GenomicCoordinates ; owl:cardinality "1" ; rdfs:comment "Start and stop coordinates of the full CDS region" . affx:hasExon a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:ExonPlusCds ; owl:minCardinality "1" ; rdfs:comment "Here, exons are defined only by their coordinates " . affx:ExonPlusCds a owl:Class ; owl:hasProperty affx:relatesToExon ; owl:hasProperty affx:cdsType ; owl:hasProperty affx:cdsStart ; owl:hasProperty affx:cdsStop ; owl:hasProperty affx:frame . affx:relatesToExon a owl:ObjectProperty ; owl:domain affx:ExonWithCds ; owl:range affx:Exon ; owl:cardinality "1" ; rdfs:comment "For associating exons with properties such as frame" . affx:Exon a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:commonToAll ; rdfs:comment "Defines the coordinates of an exon on the genome" . affx:GenomicSpan a owl:Class ; rdfs:subClassOf affx:GenomicCoordinates ; rdfs:comment "This defines a region of _ungapped_ genomic alignment" . affx:GenomicCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Start and stop, possibly with intervening gaps " ; rdfs:comment "Strand and chr will be specified at the gene level " . affx:Coordinates a owl:Class ; owl:hasProperty affx:startsAt ; owl:hasProperty affx:stopsAt . affx:startsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:stopsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:cdsType a owl:ObjectProperty ; owl:domain affx:ExonPlusCds ; owl:range rdfs:Literal ; rdfs:comment "Expected CDS types are Full, Partial, and None" . affx:commonToAll a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Shows if all the gene's variants share this object" . affx:CdsOccupancy a owl:Class ; rdfs:subClassOf rdfs:Literal . affx:cdsStart a owl:ObjectProperty ; rdfs:subClassOf affx:startsAt ; rdfs:comment "For indicating where a specific CDS region starts" . affx:cdsStop a owl:ObjectProperty ; rdfs:subClassOf affx:stopsAt ; rdfs:comment "For indicating where a specific CDS region stops" . affx:frame a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" . affx:signalPHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:SignalPeptide ; owl:cardinality "1" . affx:SignalPeptide a owl:Class ; rdfs:subClassOf affx:Annotation ; rdfs:comment "Represents a SIGNALP hit" . affx:tmHMMHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:Transmembrane ; owl:cardinality "1" . affx:Transmembrane a owl:Class ; rdfs:subClassOf affx:Annotation ; owl:hasProperty affx:helixCount ; rdfs:comment "Represents a TMHMM hit" . affx:Annotation a owl:Class ; owl:hasProperty affx:containsMotif; owl:hasProperty affx:commonToAll ; owl:hasProperty affx:motifCount . affx:containsMotif a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range affx:Motif ; owl:minCardinality "1" . affx:motifCount a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Number of motifs (eg. TM passes) in this annotation" . affx:Motif a owl:Class ; owl:hasProperty affx:hasProteinSpan . affx:hasProteinSpan a owl:ObjectProperty ; owl:domain affx:Motif ; owl:range affx:ProteinSpan . affx:ProteinCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Coordinates onto the protein sequence, possibly gapped ". affx:spannedBy a owl:ObjectProperty ; owl:domain affx:ProteinSpan ; owl:range affx:CdsSpan ; owl:minCardinality "1" . affx:ProteinSpan a owl:Class ; rdfs:subClassOf affx:ProteinCoordinates ; owl:hasProperty affx:spannedBy ; rdfs:comment "An ungapped region of the protein sequence " ; rdfs:comment "Each ProteinSpan as one or more corresponding CDS span" . affx:CdsSpan a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:inFrame ; rdfs:comment "A CDS span is a genomic span with a translation frame" ; rdfs:comment "Each CDS span describes a part of the full CDS region" . :Cor1 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi2613018] . :gi2613018 a affx:Transcript ; affx:unigene "iMm.16497" ; affx:translatesTo "MSTGSLSDVEDLQEVEMLDCDSLKVDSNKEFGTSNESTEEGSNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPENDLKEVVTANRLCGTTAS" ; affx:hasCds [affx:startsAt "22758629" ; affx:stopsAt "22760796" ]; affx:hasExon [ affx:relatesToExon :Cor1_e1; affx:cdsType "Partial" ; affx:cdsStart "22758629" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Cor1_e2; affx:cdsType "Partial" ; affx:cdsStop "22760796" ; affx:frame "2"] ; . :Cor1_e1 a affx:Exon ; affx:startsAt "22758164" ; affx:stopsAt "22758719" ; affx:commonToAll "1" . :Cor1_e2 a affx:Exon ; affx:startsAt "22760346" ; affx:stopsAt "22761008" ; affx:commonToAll "1" . :Gene511 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi15029889] . :gi15029889 a affx:Transcript ; affx:unigene "iMm.989" ; affx:translatesTo "MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKRGFTKLVYQNIFTAMQAMVRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV" ; affx:hasCds [affx:startsAt "82005967" ; affx:stopsAt "82020100" ]; affx:hasExon [ affx:relatesToExon :Gene511_e1; affx:cdsType "Partial" ; affx:cdsStart "82005967" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene511_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene511_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene511_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene511_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene511_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene511_e7; affx:cdsType "Partial" ; affx:cdsStop "82020100" ; affx:frame "0"] ; . :Gene511_e1 a affx:Exon ; affx:startsAt "82005766" ; affx:stopsAt "82006158" ; affx:commonToAll "1" . :Gene511_e2 a affx:Exon ; affx:startsAt "82006264" ; affx:stopsAt "82006418" ; affx:commonToAll "1" . :Gene511_e3 a affx:Exon ; affx:startsAt "82006494" ; affx:stopsAt "82006624" ; affx:commonToAll "1" . :Gene511_e4 a affx:Exon ; affx:startsAt "82007568" ; affx:stopsAt "82007697" ; affx:commonToAll "1" . :Gene511_e5 a affx:Exon ; affx:startsAt "82008424" ; affx:stopsAt "82008579" ; affx:commonToAll "1" . :Gene511_e6 a affx:Exon ; affx:startsAt "82010252" ; affx:stopsAt "82010437" ; affx:commonToAll "1" . :Gene511_e7 a affx:Exon ; affx:startsAt "82019964" ; affx:stopsAt "82020218" ; affx:commonToAll "1" . :Gadd45b a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6678979] . :gi6678979 a affx:Transcript ; affx:unigene "iMm.1360" ; affx:translatesTo "MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCLLVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER" ; affx:hasCds [affx:startsAt "81401100" ; affx:stopsAt "81402431" ]; affx:hasExon [ affx:relatesToExon :Gadd45b_e1; affx:cdsType "Partial" ; affx:cdsStart "81401100" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gadd45b_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gadd45b_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gadd45b_e4; affx:cdsType "Partial" ; affx:cdsStop "81402431" ; affx:frame "0"] ; . :Gadd45b_e1 a affx:Exon ; affx:startsAt "81400875" ; affx:stopsAt "81401144" ; affx:commonToAll "1" . :Gadd45b_e2 a affx:Exon ; affx:startsAt "81401232" ; affx:stopsAt "81401334" ; affx:commonToAll "1" . :Gadd45b_e3 a affx:Exon ; affx:startsAt "81401813" ; affx:stopsAt "81402036" ; affx:commonToAll "1" . :Gadd45b_e4 a affx:Exon ; affx:startsAt "81402317" ; affx:stopsAt "81402989" ; affx:commonToAll "1" . :Galgt1 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6679928] . :gi6679928 a affx:Transcript ; affx:unigene "iMm.1853" ; affx:translatesTo "MRLDRRALYALVLLLACASLGLLYSSTRNAPSLPNPLALWSPPQGPPRLDLLDLAPEPRYAHIPVRIKEQVVGLLAQNNCSCESKGGSLPLPFLRQVRAVDLTKAFDAEELRAVSVAREQEYQAFLARSRSLADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQEASVQEIYQVNLSASLGTWDVAGEVTGVTLTGEGQPDLTLASPVLDKLNRQLQLVTYSSRSYQANTADTVRFSTKGHEVAFTILVRHPPNPRLYPPSSLPQGAEYNISALVTIATKTFLRYDRLRTLIASIRRFYPTVTIVIADDSDKPERISDPHVEHYFMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLEKLVDVLEKTPLDLVGGAVREISGYATTYRQLLSVEPGAPGLGNCFRQKQGFHHELVGFPSCVVTDGVVNFFLARTDKVRQVGFDPRLNRVAHLEFFLDGLGFLRVGSCSDVVVDHASKVKLPWTAKDPGAETYARYRYPGSLDQSQVAKHRLLFFKHRLQCMTAE" ; affx:hasCds [affx:startsAt "127814930" ; affx:stopsAt "127820811" ]; affx:hasExon [ affx:relatesToExon :Galgt1_e1; affx:cdsType "Partial" ; affx:cdsStart "127814930" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Galgt1_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Galgt1_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Galgt1_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Galgt1_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Galgt1_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Galgt1_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Galgt1_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Galgt1_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Galgt1_e10; affx:cdsType "Partial" ; affx:cdsStop "127820811" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "25" ; affx:spannedBy [ affx:startsAt "127814930" ; affx:stopsAt "127815005" ; affx:inFrame "0" ] ; ] ; ] ; . :Galgt1_e1 a affx:Exon ; affx:startsAt "127814802" ; affx:stopsAt "127815148" ; affx:commonToAll "1" . :Galgt1_e2 a affx:Exon ; affx:startsAt "127815643" ; affx:stopsAt "127815808" ; affx:commonToAll "1" . :Galgt1_e3 a affx:Exon ; affx:startsAt "127815924" ; affx:stopsAt "127816031" ; affx:commonToAll "1" . :Galgt1_e4 a affx:Exon ; affx:startsAt "127816427" ; affx:stopsAt "127816468" ; affx:commonToAll "1" . :Galgt1_e5 a affx:Exon ; affx:startsAt "127816626" ; affx:stopsAt "127816807" ; affx:commonToAll "1" . :Galgt1_e6 a affx:Exon ; affx:startsAt "127818669" ; affx:stopsAt "127818768" ; affx:commonToAll "1" . :Galgt1_e7 a affx:Exon ; affx:startsAt "127818955" ; affx:stopsAt "127819146" ; affx:commonToAll "1" . :Galgt1_e8 a affx:Exon ; affx:startsAt "127819568" ; affx:stopsAt "127819709" ; affx:commonToAll "1" . :Galgt1_e9 a affx:Exon ; affx:startsAt "127819896" ; affx:stopsAt "127820137" ; affx:commonToAll "1" . :Galgt1_e10 a affx:Exon ; affx:startsAt "127820593" ; affx:stopsAt "127821199" ; affx:commonToAll "1" . :Zneurok1 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6014637] . :gi6014637 a affx:Transcript ; affx:unigene "iMm.2374" ; affx:translatesTo "MRSAMLFAAVLALSLAWTFGAVCEEPQGQGGRLSKDSDLYQLPPSLLRRLYDSRPVSLEGLLKVLSKASVGPKETSLPQKRDMHDFFVGLMGKRNSQPDTPTDVVEENTPSFGILK" ; affx:hasCds [affx:startsAt "128380837" ; affx:stopsAt "128384338" ]; affx:hasExon [ affx:relatesToExon :Zneurok1_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Zneurok1_e2; affx:cdsType "Partial" ; affx:cdsStart "128380837" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zneurok1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Zneurok1_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Zneurok1_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Zneurok1_e6; affx:cdsType "Partial" ; affx:cdsStop "128384338" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zneurok1_e7; affx:cdsType "None" ] ; . :Zneurok1_e1 a affx:Exon ; affx:startsAt "128380234" ; affx:stopsAt "128380274" ; affx:commonToAll "1" . :Zneurok1_e2 a affx:Exon ; affx:startsAt "128380819" ; affx:stopsAt "128380942" ; affx:commonToAll "1" . :Zneurok1_e3 a affx:Exon ; affx:startsAt "128382977" ; affx:stopsAt "128383083" ; affx:commonToAll "1" . :Zneurok1_e4 a affx:Exon ; affx:startsAt "128383253" ; affx:stopsAt "128383283" ; affx:commonToAll "1" . :Zneurok1_e5 a affx:Exon ; affx:startsAt "128383920" ; affx:stopsAt "128383974" ; affx:commonToAll "1" . :Zneurok1_e6 a affx:Exon ; affx:startsAt "128384282" ; affx:stopsAt "128384356" ; affx:commonToAll "1" . :Zneurok1_e7 a affx:Exon ; affx:startsAt "128386355" ; affx:stopsAt "128386575" ; affx:commonToAll "1" . :L-fyn_T_ a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi1575676] . :gi1575676 a affx:Transcript ; affx:unigene "iMm.4848" ; affx:translatesTo "MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSEKADGLCFNLTVVSSSCTPQTSGLAKDAWEVARDSLFLEKKLGQGCFAEVWLGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL" ; affx:hasCds [affx:startsAt "39539092" ; affx:stopsAt "39590898" ]; affx:hasExon [ affx:relatesToExon :L-fyn_T__e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e4; affx:cdsType "Partial" ; affx:cdsStart "39539092" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :L-fyn_T__e14; affx:cdsType "Partial" ; affx:cdsStop "39590898" ; affx:frame "0"] ; . :L-fyn_T__e1 a affx:Exon ; affx:startsAt "39397763" ; affx:stopsAt "39397868" ; affx:commonToAll "1" . :L-fyn_T__e2 a affx:Exon ; affx:startsAt "39422682" ; affx:stopsAt "39422722" ; affx:commonToAll "1" . :L-fyn_T__e3 a affx:Exon ; affx:startsAt "39482256" ; affx:stopsAt "39482326" ; affx:commonToAll "1" . :L-fyn_T__e4 a affx:Exon ; affx:startsAt "39539081" ; affx:stopsAt "39539339" ; affx:commonToAll "1" . :L-fyn_T__e5 a affx:Exon ; affx:startsAt "39542915" ; affx:stopsAt "39543012" ; affx:commonToAll "1" . :L-fyn_T__e6 a affx:Exon ; affx:startsAt "39550096" ; affx:stopsAt "39550195" ; affx:commonToAll "1" . :L-fyn_T__e7 a affx:Exon ; affx:startsAt "39552743" ; affx:stopsAt "39552847" ; affx:commonToAll "1" . :L-fyn_T__e8 a affx:Exon ; affx:startsAt "39553731" ; affx:stopsAt "39553881" ; affx:commonToAll "1" . :L-fyn_T__e9 a affx:Exon ; affx:startsAt "39556870" ; affx:stopsAt "39557026" ; affx:commonToAll "1" . :L-fyn_T__e10 a affx:Exon ; affx:startsAt "39558967" ; affx:stopsAt "39559147" ; affx:commonToAll "1" . :L-fyn_T__e11 a affx:Exon ; affx:startsAt "39560585" ; affx:stopsAt "39560662" ; affx:commonToAll "1" . :L-fyn_T__e12 a affx:Exon ; affx:startsAt "39560760" ; affx:stopsAt "39560914" ; affx:commonToAll "1" . :L-fyn_T__e13 a affx:Exon ; affx:startsAt "39578414" ; affx:stopsAt "39578546" ; affx:commonToAll "1" . :L-fyn_T__e14 a affx:Exon ; affx:startsAt "39590689" ; affx:stopsAt "39592307" ; affx:commonToAll "1" . :Tacr2 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6678212] . :gi6678212 a affx:Transcript ; affx:unigene "iMm.8054" ; affx:translatesTo "MGAHASVTDTNILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILAHERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGSTFCYFQNLFPVTAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVIWLVALALASPQCFYSTITVDQGATKCVVAWPNDNGGKMLLLYHLVVFVLIYFLPLVVMFAAYSVIGLTLWKRAVPRHQAHGANLRHLQAKKKFVKAMVLVVVTFAICWLPYHLYFILGTFQEDIYYRKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWGTPTEEDRLELTHTPSISRRVNRCHTKETLFMTGDMTHSEATNGQVGGPQDGEPAGP" ; affx:hasCds [affx:startsAt "62272337" ; affx:stopsAt "62284787" ]; affx:hasExon [ affx:relatesToExon :Tacr2_e1; affx:cdsType "Partial" ; affx:cdsStart "62272337" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tacr2_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tacr2_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tacr2_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tacr2_e5; affx:cdsType "Partial" ; affx:cdsStop "62284787" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "36" ; affx:stopsAt "58" ; affx:spannedBy [ affx:startsAt "62272445" ; affx:stopsAt "62272511" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "70" ; affx:stopsAt "92" ; affx:spannedBy [ affx:startsAt "62272547" ; affx:stopsAt "62272613" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "107" ; affx:stopsAt "129" ; affx:spannedBy [ affx:startsAt "62272658" ; affx:stopsAt "62272724" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "150" ; affx:stopsAt "172" ; affx:spannedBy [ affx:startsAt "62277735" ; affx:stopsAt "62277801" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "199" ; affx:stopsAt "221" ; affx:spannedBy [ affx:startsAt "62280701" ; affx:stopsAt "62280767" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "251" ; affx:stopsAt "273" ; affx:spannedBy [ affx:startsAt "62281015" ; affx:stopsAt "62281081" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "288" ; affx:stopsAt "310" ; affx:spannedBy [ affx:startsAt "62281126" ; affx:stopsAt "62281192" ; affx:inFrame "0" ] ; ] ; ] ; . :Tacr2_e1 a affx:Exon ; affx:startsAt "62271957" ; affx:stopsAt "62272729" ; affx:commonToAll "1" . :Tacr2_e2 a affx:Exon ; affx:startsAt "62277677" ; affx:stopsAt "62277872" ; affx:commonToAll "1" . :Tacr2_e3 a affx:Exon ; affx:startsAt "62280691" ; affx:stopsAt "62280845" ; affx:commonToAll "1" . :Tacr2_e4 a affx:Exon ; affx:startsAt "62281003" ; affx:stopsAt "62281200" ; affx:commonToAll "1" . :Tacr2_e5 a affx:Exon ; affx:startsAt "62284570" ; affx:stopsAt "62284807" ; affx:commonToAll "1" . :Gene517 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi193879] ; affx:hasVariant [affx:representedBy :gi6678302] . :gi193879 a affx:Transcript ; affx:unigene "iMm.41766" ; affx:translatesTo "MGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH" ; affx:hasCds [affx:startsAt "71422594" ; affx:stopsAt "71431036" ]; affx:hasExon [ affx:relatesToExon :Gene517_e2; affx:cdsType "Partial" ; affx:cdsStart "71422594" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene517_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene517_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene517_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene517_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene517_e8; affx:cdsType "Partial" ; affx:cdsStop "71431036" ; affx:frame "0"] ; . :gi6678302 a affx:Transcript ; affx:unigene "iMm.41766" ; affx:translatesTo "MALFRGMWSVLKALGRTGVEMCAGCGGRIPSSISLVCIPKCFSSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH" ; affx:hasCds [affx:startsAt "71422594" ; affx:stopsAt "71431976" ]; affx:hasExon [ affx:relatesToExon :Gene517_e1; affx:cdsType "Partial" ; affx:cdsStart "71422594" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene517_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene517_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene517_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene517_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene517_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene517_e9; affx:cdsType "Partial" ; affx:cdsStop "71431976" ; affx:frame "1"] ; . :Gene517_e1 a affx:Exon ; affx:startsAt "71421974" ; affx:stopsAt "71422735" ; affx:commonToAll "0" . :Gene517_e2 a affx:Exon ; affx:startsAt "71422482" ; affx:stopsAt "71422735" ; affx:commonToAll "0" . :Gene517_e3 a affx:Exon ; affx:startsAt "71423122" ; affx:stopsAt "71423179" ; affx:commonToAll "1" . :Gene517_e4 a affx:Exon ; affx:startsAt "71427392" ; affx:stopsAt "71427488" ; affx:commonToAll "1" . :Gene517_e5 a affx:Exon ; affx:startsAt "71428900" ; affx:stopsAt "71429050" ; affx:commonToAll "1" . :Gene517_e6 a affx:Exon ; affx:startsAt "71429578" ; affx:stopsAt "71429649" ; affx:commonToAll "1" . :Gene517_e7 a affx:Exon ; affx:startsAt "71430951" ; affx:stopsAt "71431067" ; affx:commonToAll "0" . :Gene517_e8 a affx:Exon ; affx:startsAt "71430951" ; affx:stopsAt "71431068" ; affx:commonToAll "0" . :Gene517_e9 a affx:Exon ; affx:startsAt "71431875" ; affx:stopsAt "71432072" ; affx:commonToAll "0" . :Tbxa2r a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6678232] . :gi6678232 a affx:Transcript ; affx:unigene "iMm.4545" ; affx:translatesTo "MWPNGTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRSSFLALLCGLVLTDFLGLLVTGAIVASQHAALLDWRATDPSCRLCYFMGVAMVFFGLCPLLLGAAMASERFVGITRPFSRPTATSRRAWATVGLVWVAAGALGLLPLLGLGRYSVQYPGSWCFLTLGTQRGDVVFGLIFALLGSASVGLSLLLNTVSVATLCRVYHTREATQRPRDCEVEMMVQLVGIMVVATVCWMPLLVFIMQTLLQTPPVMSFSGQLLRATEHQLLIYLRVATWNQILDPWVYILFRRSVLRRLHPRFSSQLQAVSLRRPPAQAMLSGP" ; affx:hasCds [affx:startsAt "81807266" ; affx:stopsAt "81809495" ]; affx:hasExon [ affx:relatesToExon :Tbxa2r_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Tbxa2r_e2; affx:cdsType "Partial" ; affx:cdsStart "81807266" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tbxa2r_e3; affx:cdsType "Partial" ; affx:cdsStop "81809495" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "6" ; affx:containsMotif [ affx:startsAt "29" ; affx:stopsAt "51" ; affx:spannedBy [ affx:startsAt "81807353" ; affx:stopsAt "81807419" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "63" ; affx:stopsAt "85" ; affx:spannedBy [ affx:startsAt "81807455" ; affx:stopsAt "81807521" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "105" ; affx:stopsAt "127" ; affx:spannedBy [ affx:startsAt "81807581" ; affx:stopsAt "81807647" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "148" ; affx:stopsAt "170" ; affx:spannedBy [ affx:startsAt "81807710" ; affx:stopsAt "81807776" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "190" ; affx:stopsAt "212" ; affx:spannedBy [ affx:startsAt "81807836" ; affx:stopsAt "81807902" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "244" ; affx:stopsAt "266" ; affx:spannedBy [ affx:startsAt "81807998" ; affx:stopsAt "81808043" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "81809246" ; affx:stopsAt "81809267" ; affx:inFrame "1" ] ; ] ; ] ; . :Tbxa2r_e1 a affx:Exon ; affx:startsAt "81803617" ; affx:stopsAt "81803705" ; affx:commonToAll "1" . :Tbxa2r_e2 a affx:Exon ; affx:startsAt "81807179" ; affx:stopsAt "81808043" ; affx:commonToAll "1" . :Tbxa2r_e3 a affx:Exon ; affx:startsAt "81809246" ; affx:stopsAt "81809959" ; affx:commonToAll "1" . :Ggtla1 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi7549760] . :gi7549760 a affx:Transcript ; affx:unigene "iMm.18263" ; affx:translatesTo "MAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRAAVAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKVEIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLREGFRVPFILSQFLNNSILRPHLSASTLRQLFFNGTETLRSQDPFPWPALANTLETVAKEGAEVLYTGRLGRMLVEDIAKQGSLLTVQDLAAFQPEVVEPLEMPLGNYTLYSPPPPAGGAILSFILNVLKGFNFSAETVARPGGEVNMYHHLVETLKFAVGQRWRLWDPSSHPGIQNISRDLLREDLAQRIRQQIDGRGDHHQLSHYNLTGVRGNRMGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGILLNNELLDLCWRHMPTSPITPPPVPGERPPSSMVPSILVNKGQGSKLVIGGAGGELIISAVAQTIMNKLWLGFDLTEAIASPILHVNSKGHVEYEPKFNQEVQKGLQDRGQIQSQSQRPVFLNAVQAVFQEGPCVYAASDLRKAGKASGY" ; affx:hasCds [affx:startsAt "76021789" ; affx:stopsAt "76046960" ]; affx:hasExon [ affx:relatesToExon :Ggtla1_e1; affx:cdsType "Partial" ; affx:cdsStart "76021789" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Ggtla1_e12; affx:cdsType "Partial" ; affx:cdsStop "76046960" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "26" ; affx:spannedBy [ affx:startsAt "76021789" ; affx:stopsAt "76021867" ; affx:inFrame "0" ] ; ] ; ] ; . :Ggtla1_e1 a affx:Exon ; affx:startsAt "76021475" ; affx:stopsAt "76021962" ; affx:commonToAll "1" . :Ggtla1_e2 a affx:Exon ; affx:startsAt "76034697" ; affx:stopsAt "76034828" ; affx:commonToAll "1" . :Ggtla1_e3 a affx:Exon ; affx:startsAt "76035051" ; affx:stopsAt "76035147" ; affx:commonToAll "1" . :Ggtla1_e4 a affx:Exon ; affx:startsAt "76036044" ; affx:stopsAt "76036240" ; affx:commonToAll "1" . :Ggtla1_e5 a affx:Exon ; affx:startsAt "76036720" ; affx:stopsAt "76036878" ; affx:commonToAll "1" . :Ggtla1_e6 a affx:Exon ; affx:startsAt "76037333" ; affx:stopsAt "76037480" ; affx:commonToAll "1" . :Ggtla1_e7 a affx:Exon ; affx:startsAt "76040828" ; affx:stopsAt "76040965" ; affx:commonToAll "1" . :Ggtla1_e8 a affx:Exon ; affx:startsAt "76041276" ; affx:stopsAt "76041470" ; affx:commonToAll "1" . :Ggtla1_e9 a affx:Exon ; affx:startsAt "76041922" ; affx:stopsAt "76042029" ; affx:commonToAll "1" . :Ggtla1_e10 a affx:Exon ; affx:startsAt "76042190" ; affx:stopsAt "76042309" ; affx:commonToAll "1" . :Ggtla1_e11 a affx:Exon ; affx:startsAt "76042505" ; affx:stopsAt "76042616" ; affx:commonToAll "1" . :Ggtla1_e12 a affx:Exon ; affx:startsAt "76046807" ; affx:stopsAt "76047263" ; affx:commonToAll "1" . :pGluRbeta-2 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi220408] ; affx:hasVariant [affx:representedBy :gi6754073] . :gi220408 a affx:Transcript ; affx:unigene "iMm.5135" ; affx:translatesTo "MKIISPVLSNLVFSRSIKVLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKTLNWKRGPSVAPWWKN" ; affx:hasCds [affx:startsAt "49225453" ; affx:stopsAt "49919396" ]; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e2; affx:cdsType "Partial" ; affx:cdsStart "49225453" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e4; affx:cdsType "Partial" ; affx:cdsStop "49237710" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e19; affx:cdsType "Partial" ; affx:cdsStop "49919396" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "31" ; affx:spannedBy [ affx:startsAt "49919303" ; affx:stopsAt "49919396" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "563" ; affx:stopsAt "582" ; affx:spannedBy [ affx:startsAt "49402007" ; affx:stopsAt "49402064" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "639" ; affx:stopsAt "661" ; affx:spannedBy [ affx:startsAt "49369938" ; affx:stopsAt "49370004" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "822" ; affx:stopsAt "844" ; affx:spannedBy [ affx:startsAt "49237717" ; affx:stopsAt "49237783" ; affx:inFrame "0" ] ; ] ; ] ; . :gi6754073 a affx:Transcript ; affx:unigene "iMm.5135" ; affx:translatesTo "MKIISPVLSNLVFSRSIKVLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKESSIWLVPPYHPDTV" ; affx:hasCds [affx:startsAt "49229335" ; affx:stopsAt "49919396" ]; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e3; affx:cdsType "Partial" ; affx:cdsStart "49229335" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :pGluRbeta-2_e18; affx:cdsType "Partial" ; affx:cdsStop "49919396" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "31" ; affx:spannedBy [ affx:startsAt "49919303" ; affx:stopsAt "49919396" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "563" ; affx:stopsAt "582" ; affx:spannedBy [ affx:startsAt "49402007" ; affx:stopsAt "49402064" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "639" ; affx:stopsAt "661" ; affx:spannedBy [ affx:startsAt "49369938" ; affx:stopsAt "49370004" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "822" ; affx:stopsAt "844" ; affx:spannedBy [ affx:startsAt "49237717" ; affx:stopsAt "49237783" ; affx:inFrame "0" ] ; ] ; ] ; . :pGluRbeta-2_e1 a affx:Exon ; affx:startsAt "49225203" ; affx:stopsAt "49225487" ; affx:commonToAll "0" . :pGluRbeta-2_e2 a affx:Exon ; affx:startsAt "49225381" ; affx:stopsAt "49225487" ; affx:commonToAll "0" . :pGluRbeta-2_e3 a affx:Exon ; affx:startsAt "49229296" ; affx:stopsAt "49229383" ; affx:commonToAll "0" . :pGluRbeta-2_e4 a affx:Exon ; affx:startsAt "49237687" ; affx:stopsAt "49237938" ; affx:commonToAll "1" . :pGluRbeta-2_e5 a affx:Exon ; affx:startsAt "49256800" ; affx:stopsAt "49257026" ; affx:commonToAll "1" . :pGluRbeta-2_e6 a affx:Exon ; affx:startsAt "49369836" ; affx:stopsAt "49370054" ; affx:commonToAll "1" . :pGluRbeta-2_e7 a affx:Exon ; affx:startsAt "49373582" ; affx:stopsAt "49373701" ; affx:commonToAll "1" . :pGluRbeta-2_e8 a affx:Exon ; affx:startsAt "49402005" ; affx:stopsAt "49402229" ; affx:commonToAll "1" . :pGluRbeta-2_e9 a affx:Exon ; affx:startsAt "49486222" ; affx:stopsAt "49486429" ; affx:commonToAll "1" . :pGluRbeta-2_e10 a affx:Exon ; affx:startsAt "49538246" ; affx:stopsAt "49538360" ; affx:commonToAll "1" . :pGluRbeta-2_e11 a affx:Exon ; affx:startsAt "49553577" ; affx:stopsAt "49553685" ; affx:commonToAll "1" . :pGluRbeta-2_e12 a affx:Exon ; affx:startsAt "49556438" ; affx:stopsAt "49556582" ; affx:commonToAll "1" . :pGluRbeta-2_e13 a affx:Exon ; affx:startsAt "49658279" ; affx:stopsAt "49658453" ; affx:commonToAll "1" . :pGluRbeta-2_e14 a affx:Exon ; affx:startsAt "49662584" ; affx:stopsAt "49662638" ; affx:commonToAll "1" . :pGluRbeta-2_e15 a affx:Exon ; affx:startsAt "49670011" ; affx:stopsAt "49670193" ; affx:commonToAll "1" . :pGluRbeta-2_e16 a affx:Exon ; affx:startsAt "49708342" ; affx:stopsAt "49708600" ; affx:commonToAll "1" . :pGluRbeta-2_e17 a affx:Exon ; affx:startsAt "49712907" ; affx:stopsAt "49713075" ; affx:commonToAll "1" . :pGluRbeta-2_e18 a affx:Exon ; affx:startsAt "49919281" ; affx:stopsAt "49919546" ; affx:commonToAll "0" . :pGluRbeta-2_e19 a affx:Exon ; affx:startsAt "49919281" ; affx:stopsAt "49919685" ; affx:commonToAll "0" . :Gene521 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi1218043] ; affx:hasVariant [affx:representedBy :gi6754087] . :gi1218043 a affx:Transcript ; affx:unigene "iMm.24118" ; affx:translatesTo "MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKKMLPVPPPEVHASMQLRIARIP" ; affx:hasCds [affx:startsAt "76266983" ; affx:stopsAt "76269386" ]; affx:hasExon [ affx:relatesToExon :Gene521_e1; affx:cdsType "Partial" ; affx:cdsStart "76266983" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene521_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene521_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene521_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene521_e8; affx:cdsType "Partial" ; affx:cdsStop "76269386" ; affx:frame "0"] ; . :gi6754087 a affx:Transcript ; affx:unigene "iMm.24118" ; affx:translatesTo "MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKQHMSEQFSQVNCLNKVPVLKDGSFVLTERTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKKMLPVPPPEVHASMQLRIARIP" ; affx:hasCds [affx:startsAt "76266983" ; affx:stopsAt "76269386" ]; affx:hasExon [ affx:relatesToExon :Gene521_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene521_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene521_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene521_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene521_e9; affx:cdsType "Full" ; affx:frame "2"] ; . :Gene521_e1 a affx:Exon ; affx:startsAt "76266948" ; affx:stopsAt "76267193" ; affx:commonToAll "0" . :Gene521_e2 a affx:Exon ; affx:startsAt "76266983" ; affx:stopsAt "76267193" ; affx:commonToAll "0" . :Gene521_e3 a affx:Exon ; affx:startsAt "76267494" ; affx:stopsAt "76267668" ; affx:commonToAll "1" . :Gene521_e4 a affx:Exon ; affx:startsAt "76267760" ; affx:stopsAt "76267910" ; affx:commonToAll "0" . :Gene521_e5 a affx:Exon ; affx:startsAt "76267760" ; affx:stopsAt "76267911" ; affx:commonToAll "0" . :Gene521_e6 a affx:Exon ; affx:startsAt "76268750" ; affx:stopsAt "76268837" ; affx:commonToAll "0" . :Gene521_e7 a affx:Exon ; affx:startsAt "76268751" ; affx:stopsAt "76268839" ; affx:commonToAll "0" . :Gene521_e8 a affx:Exon ; affx:startsAt "76269274" ; affx:stopsAt "76269513" ; affx:commonToAll "0" . :Gene521_e9 a affx:Exon ; affx:startsAt "76269275" ; affx:stopsAt "76269386" ; affx:commonToAll "0" . :Gene522 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi15278001] ; affx:hasVariant [affx:representedBy :gi6679994] . :gi15278001 a affx:Transcript ; affx:unigene "iMm.4559" ; affx:translatesTo "MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATDAKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVINAREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLSGPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQVIRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTINLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIILDKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKDIDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY" ; affx:hasCds [affx:startsAt "76006316" ; affx:stopsAt "76018107" ]; affx:hasExon [ affx:relatesToExon :Gene522_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene522_e3; affx:cdsType "Partial" ; affx:cdsStart "76006316" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene522_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene522_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene522_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene522_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene522_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene522_e16; affx:cdsType "Partial" ; affx:cdsStop "76018107" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "31" ; affx:spannedBy [ affx:startsAt "76006316" ; affx:stopsAt "76006409" ; affx:inFrame "0" ] ; ] ; ] ; . :gi6679994 a affx:Transcript ; affx:unigene "iMm.4559" ; affx:translatesTo "MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATDAKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVINAREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLSGPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQVIRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTINLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIILDKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKDIDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY" ; affx:hasCds [affx:startsAt "76006316" ; affx:stopsAt "76018107" ]; affx:hasExon [ affx:relatesToExon :Gene522_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene522_e4; affx:cdsType "Partial" ; affx:cdsStart "76006316" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene522_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene522_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene522_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene522_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene522_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene522_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene522_e15; affx:cdsType "Partial" ; affx:cdsStop "76018107" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "31" ; affx:spannedBy [ affx:startsAt "76006316" ; affx:stopsAt "76006409" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene522_e1 a affx:Exon ; affx:startsAt "76005673" ; affx:stopsAt "76005829" ; affx:commonToAll "0" . :Gene522_e2 a affx:Exon ; affx:startsAt "76005705" ; affx:stopsAt "76005829" ; affx:commonToAll "0" . :Gene522_e3 a affx:Exon ; affx:startsAt "76006309" ; affx:stopsAt "76006477" ; affx:commonToAll "0" . :Gene522_e4 a affx:Exon ; affx:startsAt "76006312" ; affx:stopsAt "76006477" ; affx:commonToAll "0" . :Gene522_e5 a affx:Exon ; affx:startsAt "76008029" ; affx:stopsAt "76008160" ; affx:commonToAll "1" . :Gene522_e6 a affx:Exon ; affx:startsAt "76008295" ; affx:stopsAt "76008382" ; affx:commonToAll "1" . :Gene522_e7 a affx:Exon ; affx:startsAt "76010808" ; affx:stopsAt "76011001" ; affx:commonToAll "1" . :Gene522_e8 a affx:Exon ; affx:startsAt "76011305" ; affx:stopsAt "76011463" ; affx:commonToAll "1" . :Gene522_e9 a affx:Exon ; affx:startsAt "76012583" ; affx:stopsAt "76012733" ; affx:commonToAll "1" . :Gene522_e10 a affx:Exon ; affx:startsAt "76013376" ; affx:stopsAt "76013513" ; affx:commonToAll "1" . :Gene522_e11 a affx:Exon ; affx:startsAt "76016899" ; affx:stopsAt "76017087" ; affx:commonToAll "1" . :Gene522_e12 a affx:Exon ; affx:startsAt "76017237" ; affx:stopsAt "76017365" ; affx:commonToAll "1" . :Gene522_e13 a affx:Exon ; affx:startsAt "76017466" ; affx:stopsAt "76017579" ; affx:commonToAll "1" . :Gene522_e14 a affx:Exon ; affx:startsAt "76017670" ; affx:stopsAt "76017784" ; affx:commonToAll "1" . :Gene522_e15 a affx:Exon ; affx:startsAt "76017960" ; affx:stopsAt "76018262" ; affx:commonToAll "0" . :Gene522_e16 a affx:Exon ; affx:startsAt "76017960" ; affx:stopsAt "76018271" ; affx:commonToAll "0" . :Gene523 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi16307495] . :gi16307495 a affx:Transcript ; affx:unigene "iMm.3117" ; affx:translatesTo "MLENSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLLLIPPKQLQQQQQQQQPGQGTAEPSQPSGPTVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMTEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQPPQTQQIQPQPQPQIQPQPQPQIQPQPQPQPQPQPQPQPQPQPQQLHSYPHPHPHPYSHPHQHPHPHPHPHPHPHPHPYQLQHAHQPLHSQPQGHRLLRSTSNSA" ; affx:hasCds [affx:startsAt "111643553" ; affx:stopsAt "111644339" ]; affx:hasExon [ affx:relatesToExon :Gene523_e1; affx:cdsType "Partial" ; affx:cdsStart "111643553" ; affx:cdsStop "111644339" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene523_e2; affx:cdsType "None" ] ; . :Gene523_e1 a affx:Exon ; affx:startsAt "111643439" ; affx:stopsAt "111644365" ; affx:commonToAll "1" . :Gene523_e2 a affx:Exon ; affx:startsAt "111644776" ; affx:stopsAt "111645362" ; affx:commonToAll "1" . :Frk a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6753907] . :gi6753907 a affx:Transcript ; affx:unigene "iMm.4953" ; affx:translatesTo "MGSVCVRLWAYLQPFLPCWSQEADKSVVIENPGAFCPPEAPRSQEPERSHGQYFVALFDYQARTAEDLSFRAGDKLQVLDTSHEGWWLARHLEKKGTGLGQQLQGYIPSNYVAEDRSLQAEPWFFGAIKRADAEKQLLYSENQTGAFLIRESESQKGDFSLSVLDEGVVKHYRIRRLDEGGFFLTRRKVFSTLNEFVNYYTTTSDGLCVKLEKPCLKIQVPTPFDLSYKTADQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKSLRHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDGGSKIHLIQQVDMAAQVASGMAYLESQNYIHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESKHEIKLPVKWTAPEAIRTNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLSQNYRLPQPSNCPQQFYSIMLECWNVEPKQRPTFETLHWKLEDYFETDCSYSDTNNFIN" ; affx:hasCds [affx:startsAt "34487009" ; affx:stopsAt "34611817" ]; affx:hasExon [ affx:relatesToExon :Frk_e1; affx:cdsType "Partial" ; affx:cdsStart "34487009" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Frk_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Frk_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Frk_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Frk_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Frk_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Frk_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Frk_e8; affx:cdsType "Partial" ; affx:cdsStop "34611817" ; affx:frame "0"] ; . :Frk_e1 a affx:Exon ; affx:startsAt "34486524" ; affx:stopsAt "34487374" ; affx:commonToAll "1" . :Frk_e2 a affx:Exon ; affx:startsAt "34550493" ; affx:stopsAt "34550615" ; affx:commonToAll "1" . :Frk_e3 a affx:Exon ; affx:startsAt "34587420" ; affx:stopsAt "34587584" ; affx:commonToAll "1" . :Frk_e4 a affx:Exon ; affx:startsAt "34589688" ; affx:stopsAt "34589857" ; affx:commonToAll "1" . :Frk_e5 a affx:Exon ; affx:startsAt "34595334" ; affx:stopsAt "34595493" ; affx:commonToAll "1" . :Frk_e6 a affx:Exon ; affx:startsAt "34608940" ; affx:stopsAt "34609122" ; affx:commonToAll "1" . :Frk_e7 a affx:Exon ; affx:startsAt "34611051" ; affx:stopsAt "34611217" ; affx:commonToAll "1" . :Frk_e8 a affx:Exon ; affx:startsAt "34611605" ; affx:stopsAt "34611822" ; affx:commonToAll "1" . :Gene525 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi4262545] . :gi4262545 a affx:Transcript ; affx:unigene "iMm.42103" ; affx:translatesTo "MDTSCVHMLLSLLALLQLVAAGSSPGPDAIPRGCPSHCHCELDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLPASLLHRLCFLEELRLAGNALTHIPKGAFTGLHSLKVLMLQNNQLRQVPEEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTDVPVQAFRSLSALQAMTLALNKIHHIADYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIKTLSNLKELGFHSNNIRSIPERAFVGNPSLITIHFYDNPIQFVGVSAFQHLPELRTLTLNGASHITEFPHLTGTATLESLTLTGAKISSLPQAVCDQLPNLQVLDLSYNLLEDLPSLSGCQKLQKIDLRHNEIYEIKGSTFQQLFNLRSLNLAWNKIAIIHPNAFSTLPSLIKLDLSSNLLSSFPVTGLHGLTHLKLTGNRALQSLIPSANFPELKIIEMPSAYQCCAFGGCENVYKISNQWNKDDGNSVDDLHKKDAGLFQVQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLFGSWLIRIGVWTTAVLALSCNALVALTVFRTPLYISSIKLLIGVIAVVDILMGVSSAVLAAVDAFTFGRFAQHGAWWEDGIGCQIVGFLSIFASESSIFLLTLAALERGFSVKCSSKFEVKAPLFSLRAIVLLCVLLALTIATIPLLGGSKYNASPLCLPLPFGEPSTTGYMVALVLLNSLCFLIMTIAYTKLYCSLEKGELENLWDCSMVKHIALLLFANCILYCPVAFLSFSSLLNLTFISPDVIKFILLVIVPLPSCLNPLLYIVFNPHFKEDMGSLGKHTRFWMRSKHASLLSINSDDVEKRSCESTQALVSFTHASIAYDLPSTSGASPAYPMTESCHLSSVAFVPCL" ; affx:hasCds [affx:startsAt "115668693" ; affx:stopsAt "115804441" ]; affx:hasExon [ affx:relatesToExon :Gene525_e1; affx:cdsType "Partial" ; affx:cdsStart "115668693" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene525_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene525_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene525_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene525_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene525_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene525_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene525_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene525_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene525_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene525_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene525_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene525_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene525_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene525_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene525_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene525_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene525_e18; affx:cdsType "Full" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "21" ; affx:spannedBy [ affx:startsAt "115804378" ; affx:stopsAt "115804441" ; affx:inFrame "1" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "558" ; affx:stopsAt "580" ; affx:spannedBy [ affx:startsAt "115669677" ; affx:stopsAt "115669743" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "593" ; affx:stopsAt "615" ; affx:spannedBy [ affx:startsAt "115669572" ; affx:stopsAt "115669638" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "635" ; affx:stopsAt "657" ; affx:spannedBy [ affx:startsAt "115669446" ; affx:stopsAt "115669512" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "678" ; affx:stopsAt "700" ; affx:spannedBy [ affx:startsAt "115669317" ; affx:stopsAt "115669383" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "725" ; affx:stopsAt "747" ; affx:spannedBy [ affx:startsAt "115669176" ; affx:stopsAt "115669242" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "768" ; affx:stopsAt "790" ; affx:spannedBy [ affx:startsAt "115669047" ; affx:stopsAt "115669113" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "800" ; affx:stopsAt "822" ; affx:spannedBy [ affx:startsAt "115668951" ; affx:stopsAt "115669017" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene525_e1 a affx:Exon ; affx:startsAt "115668305" ; affx:stopsAt "115669781" ; affx:commonToAll "1" . :Gene525_e2 a affx:Exon ; affx:startsAt "115671126" ; affx:stopsAt "115671210" ; affx:commonToAll "1" . :Gene525_e3 a affx:Exon ; affx:startsAt "115673328" ; affx:stopsAt "115673474" ; affx:commonToAll "1" . :Gene525_e4 a affx:Exon ; affx:startsAt "115674437" ; affx:stopsAt "115674563" ; affx:commonToAll "1" . :Gene525_e5 a affx:Exon ; affx:startsAt "115675322" ; affx:stopsAt "115675394" ; affx:commonToAll "1" . :Gene525_e6 a affx:Exon ; affx:startsAt "115677441" ; affx:stopsAt "115677513" ; affx:commonToAll "1" . :Gene525_e7 a affx:Exon ; affx:startsAt "115679329" ; affx:stopsAt "115679395" ; affx:commonToAll "1" . :Gene525_e8 a affx:Exon ; affx:startsAt "115682837" ; affx:stopsAt "115682909" ; affx:commonToAll "1" . :Gene525_e9 a affx:Exon ; affx:startsAt "115683049" ; affx:stopsAt "115683118" ; affx:commonToAll "1" . :Gene525_e10 a affx:Exon ; affx:startsAt "115683263" ; affx:stopsAt "115683335" ; affx:commonToAll "1" . :Gene525_e11 a affx:Exon ; affx:startsAt "115687227" ; affx:stopsAt "115687299" ; affx:commonToAll "1" . :Gene525_e12 a affx:Exon ; affx:startsAt "115688630" ; affx:stopsAt "115688699" ; affx:commonToAll "1" . :Gene525_e13 a affx:Exon ; affx:startsAt "115691837" ; affx:stopsAt "115691909" ; affx:commonToAll "1" . :Gene525_e14 a affx:Exon ; affx:startsAt "115695173" ; affx:stopsAt "115695389" ; affx:commonToAll "1" . :Gene525_e15 a affx:Exon ; affx:startsAt "115711955" ; affx:stopsAt "115712027" ; affx:commonToAll "1" . :Gene525_e16 a affx:Exon ; affx:startsAt "115719067" ; affx:stopsAt "115719139" ; affx:commonToAll "1" . :Gene525_e17 a affx:Exon ; affx:startsAt "115737307" ; affx:stopsAt "115737379" ; affx:commonToAll "1" . :Gene525_e18 a affx:Exon ; affx:startsAt "115804229" ; affx:stopsAt "115804441" ; affx:commonToAll "1" . :Gamt a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6753943] . :gi6753943 a affx:Transcript ; affx:unigene "iMm.7329" ; affx:translatesTo "MSSSAASPLFAPGEDCGPAWRAAPAAYDASDTHLQILGKPVMERWETPYMHALAAAAASRGGRVLEVGFGMAIAASRVQQAPIEEHWIIECNDGVFQRLQDWALRQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEEAWHTHQFNFIKNHAFRLLKTGGVLTYCNLTSWGELMKSKYTDITTMFEETQVPALQEAGFLKENICTEVMALVPPADCRYYAFPQMITPLVTKH" ; affx:hasCds [affx:startsAt "80722090" ; affx:stopsAt "80724678" ]; affx:hasExon [ affx:relatesToExon :Gamt_e1; affx:cdsType "Partial" ; affx:cdsStart "80722090" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gamt_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gamt_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gamt_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gamt_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gamt_e6; affx:cdsType "Partial" ; affx:cdsStop "80724678" ; affx:frame "0"] ; . :Gamt_e1 a affx:Exon ; affx:startsAt "80721972" ; affx:stopsAt "80722231" ; affx:commonToAll "1" . :Gamt_e2 a affx:Exon ; affx:startsAt "80722716" ; affx:stopsAt "80722827" ; affx:commonToAll "1" . :Gamt_e3 a affx:Exon ; affx:startsAt "80722953" ; affx:stopsAt "80723021" ; affx:commonToAll "1" . :Gamt_e4 a affx:Exon ; affx:startsAt "80723377" ; affx:stopsAt "80723441" ; affx:commonToAll "1" . :Gamt_e5 a affx:Exon ; affx:startsAt "80723544" ; affx:stopsAt "80723690" ; affx:commonToAll "1" . :Gamt_e6 a affx:Exon ; affx:startsAt "80724497" ; affx:stopsAt "80724789" ; affx:commonToAll "1" . :MMET-1 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi4996112] ; affx:hasVariant [affx:representedBy :gi4996114] . :gi4996112 a affx:Transcript ; affx:unigene "iMm.22302" ; affx:translatesTo "MTHQGGPRARALQELDLRVLDTQMCNNSRFWNGVLIDSMLCLKAGSKSQAPCKGDSGGPLVCGKGQVDGILSFSSKTCTDIFKPPVATAVAPYSSWIRKVIGRWSPQSLV" ; affx:hasCds [affx:startsAt "80153547" ; affx:stopsAt "80154249" ]; affx:hasExon [ affx:relatesToExon :MMET-1_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MMET-1_e4; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MMET-1_e5; affx:cdsType "Partial" ; affx:cdsStart "80153547" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MMET-1_e6; affx:cdsType "Partial" ; affx:cdsStop "80154249" ; affx:frame "1"] ; . :gi4996114 a affx:Transcript ; affx:unigene "iMm.22302" ; affx:translatesTo "MEVCWSLLLLLALKTLWAAGNRFETQIIGGREAVPHSRPYMASLQKAKSHVCGGVLVHRKWVLTAAHCLSEPLQNLKLVLGLHNLHDLQDPGLTFYIREAIKHPGYNHKYENDLALLKLDRRVQPSKNVKPLALPRKPRSKPAEGTWCSTAGWGMTHQGGPRARALQELDLRVLDTQMCNNSRFWNGVLIDSMLCLKAGSKSQAPCKGDSGGPLVCGKGQVDGILSFSSKTCTDIFKPPVATAVAPYSSWIRKVIGRWSPQSLV" ; affx:hasCds [affx:startsAt "80148499" ; affx:stopsAt "80154249" ]; affx:hasExon [ affx:relatesToExon :MMET-1_e1; affx:cdsType "Partial" ; affx:cdsStart "80148499" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MMET-1_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MMET-1_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MMET-1_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MMET-1_e6; affx:cdsType "Partial" ; affx:cdsStop "80154249" ; affx:frame "1"] ; . :MMET-1_e1 a affx:Exon ; affx:startsAt "80148108" ; affx:stopsAt "80148554" ; affx:commonToAll "0" . :MMET-1_e2 a affx:Exon ; affx:startsAt "80151909" ; affx:stopsAt "80152069" ; affx:commonToAll "0" . :MMET-1_e3 a affx:Exon ; affx:startsAt "80152846" ; affx:stopsAt "80153031" ; affx:commonToAll "0" . :MMET-1_e4 a affx:Exon ; affx:startsAt "80153212" ; affx:stopsAt "80153351" ; affx:commonToAll "1" . :MMET-1_e5 a affx:Exon ; affx:startsAt "80153439" ; affx:stopsAt "80153706" ; affx:commonToAll "1" . :MMET-1_e6 a affx:Exon ; affx:startsAt "80154075" ; affx:stopsAt "80154349" ; affx:commonToAll "1" . :Tbk1 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi9790252] . :gi9790252 a affx:Transcript ; affx:unigene "iMm.34580" ; affx:translatesTo "MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL" ; affx:hasCds [affx:startsAt "121824126" ; affx:stopsAt "121861057" ]; affx:hasExon [ affx:relatesToExon :Tbk1_e1; affx:cdsType "Partial" ; affx:cdsStart "121824126" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e18; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbk1_e20; affx:cdsType "Partial" ; affx:cdsStop "121861057" ; affx:frame "2"] ; . :Tbk1_e1 a affx:Exon ; affx:startsAt "121823599" ; affx:stopsAt "121824178" ; affx:commonToAll "1" . :Tbk1_e2 a affx:Exon ; affx:startsAt "121828512" ; affx:stopsAt "121828584" ; affx:commonToAll "1" . :Tbk1_e3 a affx:Exon ; affx:startsAt "121828748" ; affx:stopsAt "121828855" ; affx:commonToAll "1" . :Tbk1_e4 a affx:Exon ; affx:startsAt "121829461" ; affx:stopsAt "121829558" ; affx:commonToAll "1" . :Tbk1_e5 a affx:Exon ; affx:startsAt "121829669" ; affx:stopsAt "121829771" ; affx:commonToAll "1" . :Tbk1_e6 a affx:Exon ; affx:startsAt "121830290" ; affx:stopsAt "121830330" ; affx:commonToAll "1" . :Tbk1_e7 a affx:Exon ; affx:startsAt "121831006" ; affx:stopsAt "121831083" ; affx:commonToAll "1" . :Tbk1_e8 a affx:Exon ; affx:startsAt "121831164" ; affx:stopsAt "121831286" ; affx:commonToAll "1" . :Tbk1_e9 a affx:Exon ; affx:startsAt "121833248" ; affx:stopsAt "121833327" ; affx:commonToAll "1" . :Tbk1_e10 a affx:Exon ; affx:startsAt "121834463" ; affx:stopsAt "121834565" ; affx:commonToAll "1" . :Tbk1_e11 a affx:Exon ; affx:startsAt "121837108" ; affx:stopsAt "121837200" ; affx:commonToAll "1" . :Tbk1_e12 a affx:Exon ; affx:startsAt "121837502" ; affx:stopsAt "121837561" ; affx:commonToAll "1" . :Tbk1_e13 a affx:Exon ; affx:startsAt "121838838" ; affx:stopsAt "121839035" ; affx:commonToAll "1" . :Tbk1_e14 a affx:Exon ; affx:startsAt "121841187" ; affx:stopsAt "121841367" ; affx:commonToAll "1" . :Tbk1_e15 a affx:Exon ; affx:startsAt "121845295" ; affx:stopsAt "121845406" ; affx:commonToAll "1" . :Tbk1_e16 a affx:Exon ; affx:startsAt "121847897" ; affx:stopsAt "121848058" ; affx:commonToAll "1" . :Tbk1_e17 a affx:Exon ; affx:startsAt "121849109" ; affx:stopsAt "121849291" ; affx:commonToAll "1" . :Tbk1_e18 a affx:Exon ; affx:startsAt "121853048" ; affx:stopsAt "121853178" ; affx:commonToAll "1" . :Tbk1_e19 a affx:Exon ; affx:startsAt "121855354" ; affx:stopsAt "121855495" ; affx:commonToAll "1" . :Tbk1_e20 a affx:Exon ; affx:startsAt "121860970" ; affx:stopsAt "121861095" ; affx:commonToAll "1" . :Gstt1 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6680122] . :gi6680122 a affx:Transcript ; affx:unigene "iMm.2746" ; affx:translatesTo "MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGEQIPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVFEGHPRLAAWYQRVEAAVGKDLFREAHEVILKVKDCPPADLIIKQKLMPRVLAMIQ" ; affx:hasCds [affx:startsAt "76217390" ; affx:stopsAt "76232008" ]; affx:hasExon [ affx:relatesToExon :Gstt1_e1; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gstt1_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gstt1_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gstt1_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gstt1_e5; affx:cdsType "Full" ; affx:frame "0"] ; . :Gstt1_e1 a affx:Exon ; affx:startsAt "76217390" ; affx:stopsAt "76217585" ; affx:commonToAll "1" . :Gstt1_e2 a affx:Exon ; affx:startsAt "76220146" ; affx:stopsAt "76220323" ; affx:commonToAll "1" . :Gstt1_e3 a affx:Exon ; affx:startsAt "76227587" ; affx:stopsAt "76227738" ; affx:commonToAll "1" . :Gstt1_e4 a affx:Exon ; affx:startsAt "76230553" ; affx:stopsAt "76230641" ; affx:commonToAll "1" . :Gstt1_e5 a affx:Exon ; affx:startsAt "76231896" ; affx:stopsAt "76232008" ; affx:commonToAll "1" . :Tde1l a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi9790268] . :gi9790268 a affx:Transcript ; affx:unigene "iMm.29344" ; affx:translatesTo "MGSVLGLCSVASWIPCLCGSAPCLLCRCCPSGNNSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPGFCENEKGVVPCNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFATAVAIIIGAFFIPEGTFTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSLVAVVLFFVYYTHPASCAENKAFISVNMLLCIGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPETNCNPSLLSIIGFNTTRPIPKDGQSVQWWHPQGIIGLVLFLLCVFYSSIRTSNNSQVNKLTLTSDESTLIEDGNGRSDGSLDDGDGIHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQWTAVWVKISSSWIGLVLYVWTLVAPLVLTNRDFD" ; affx:hasCds [affx:startsAt "57687582" ; affx:stopsAt "57702820" ]; affx:hasExon [ affx:relatesToExon :Tde1l_e1; affx:cdsType "Partial" ; affx:cdsStart "57687582" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tde1l_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tde1l_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tde1l_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tde1l_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tde1l_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tde1l_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tde1l_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tde1l_e9; affx:cdsType "Partial" ; affx:cdsStop "57702820" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "53" ; affx:spannedBy [ affx:startsAt "57702781" ; affx:stopsAt "57702820" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "57698132" ; affx:stopsAt "57698252" ; affx:inFrame "1" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "89" ; affx:stopsAt "111" ; affx:spannedBy [ affx:startsAt "57695788" ; affx:stopsAt "57695854" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "124" ; affx:stopsAt "143" ; affx:spannedBy [ affx:startsAt "57694767" ; affx:stopsAt "57694824" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "195" ; affx:stopsAt "217" ; affx:spannedBy [ affx:startsAt "57694386" ; affx:stopsAt "57694390" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "57693580" ; affx:stopsAt "57693642" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "232" ; affx:stopsAt "249" ; affx:spannedBy [ affx:startsAt "57693484" ; affx:stopsAt "57693535" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "311" ; affx:stopsAt "333" ; affx:spannedBy [ affx:startsAt "57690123" ; affx:stopsAt "57690185" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "57690015" ; affx:stopsAt "57690019" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "383" ; affx:stopsAt "405" ; affx:spannedBy [ affx:startsAt "57689799" ; affx:stopsAt "57689865" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "420" ; affx:stopsAt "442" ; affx:spannedBy [ affx:startsAt "57687618" ; affx:stopsAt "57687684" ; affx:inFrame "0" ] ; ] ; ] ; . :Tde1l_e1 a affx:Exon ; affx:startsAt "57686199" ; affx:stopsAt "57687718" ; affx:commonToAll "1" . :Tde1l_e2 a affx:Exon ; affx:startsAt "57689788" ; affx:stopsAt "57690019" ; affx:commonToAll "1" . :Tde1l_e3 a affx:Exon ; affx:startsAt "57690123" ; affx:stopsAt "57690268" ; affx:commonToAll "1" . :Tde1l_e4 a affx:Exon ; affx:startsAt "57693381" ; affx:stopsAt "57693642" ; affx:commonToAll "1" . :Tde1l_e5 a affx:Exon ; affx:startsAt "57694386" ; affx:stopsAt "57694524" ; affx:commonToAll "1" . :Tde1l_e6 a affx:Exon ; affx:startsAt "57694745" ; affx:stopsAt "57694825" ; affx:commonToAll "1" . :Tde1l_e7 a affx:Exon ; affx:startsAt "57695750" ; affx:stopsAt "57695920" ; affx:commonToAll "1" . :Tde1l_e8 a affx:Exon ; affx:startsAt "57698090" ; affx:stopsAt "57698252" ; affx:commonToAll "1" . :Tde1l_e9 a affx:Exon ; affx:startsAt "57702781" ; affx:stopsAt "57702874" ; affx:commonToAll "1" . :Gcn5l1 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi7657119] . :gi7657119 a affx:Transcript ; affx:unigene "iMm.30118" ; affx:translatesTo "MLSRLLKEHQAKQNERKELQEKRRREAIAAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS" ; affx:hasCds [affx:startsAt "129588744" ; affx:stopsAt "129592183" ]; affx:hasExon [ affx:relatesToExon :Gcn5l1_e1; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gcn5l1_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gcn5l1_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gcn5l1_e4; affx:cdsType "Partial" ; affx:cdsStop "129592183" ; affx:frame "0"] ; . :Gcn5l1_e1 a affx:Exon ; affx:startsAt "129588744" ; affx:stopsAt "129588855" ; affx:commonToAll "1" . :Gcn5l1_e2 a affx:Exon ; affx:startsAt "129589306" ; affx:stopsAt "129589439" ; affx:commonToAll "1" . :Gcn5l1_e3 a affx:Exon ; affx:startsAt "129591401" ; affx:stopsAt "129591474" ; affx:commonToAll "1" . :Gcn5l1_e4 a affx:Exon ; affx:startsAt "129592122" ; affx:stopsAt "129592253" ; affx:commonToAll "1" . :Gene532 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6561875] . :gi6561875 a affx:Transcript ; affx:unigene "iMm.6735" ; affx:translatesTo "MLSFQYPDVYRDETSVQEYHGHKICDPYSWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNTLSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFTCMAWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKLCYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQEPNGITGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFTDPDESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNILQLHDLTTGALLKTFPLDVGSVVGYSGRKKDSEIFYQFTSFLSPGVIYHCDLTKEELEPMVFREVTVKGIDAADYQTIQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDTKQHFEWLLKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEWIQ" ; affx:hasCds [affx:startsAt "45173287" ; affx:stopsAt "45264471" ]; affx:hasExon [ affx:relatesToExon :Gene532_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene532_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene532_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene532_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene532_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene532_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene532_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene532_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene532_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene532_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene532_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene532_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene532_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene532_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene532_e15; affx:cdsType "Full" ; affx:frame "0"] ; . :Gene532_e1 a affx:Exon ; affx:startsAt "45173287" ; affx:stopsAt "45173332" ; affx:commonToAll "1" . :Gene532_e2 a affx:Exon ; affx:startsAt "45178009" ; affx:stopsAt "45178084" ; affx:commonToAll "1" . :Gene532_e3 a affx:Exon ; affx:startsAt "45196950" ; affx:stopsAt "45197084" ; affx:commonToAll "1" . :Gene532_e4 a affx:Exon ; affx:startsAt "45198619" ; affx:stopsAt "45198750" ; affx:commonToAll "1" . :Gene532_e5 a affx:Exon ; affx:startsAt "45200938" ; affx:stopsAt "45201148" ; affx:commonToAll "1" . :Gene532_e6 a affx:Exon ; affx:startsAt "45203350" ; affx:stopsAt "45203472" ; affx:commonToAll "1" . :Gene532_e7 a affx:Exon ; affx:startsAt "45213717" ; affx:stopsAt "45213823" ; affx:commonToAll "1" . :Gene532_e8 a affx:Exon ; affx:startsAt "45221008" ; affx:stopsAt "45221200" ; affx:commonToAll "1" . :Gene532_e9 a affx:Exon ; affx:startsAt "45226588" ; affx:stopsAt "45226786" ; affx:commonToAll "1" . :Gene532_e10 a affx:Exon ; affx:startsAt "45231909" ; affx:stopsAt "45232013" ; affx:commonToAll "1" . :Gene532_e11 a affx:Exon ; affx:startsAt "45253929" ; affx:stopsAt "45254066" ; affx:commonToAll "1" . :Gene532_e12 a affx:Exon ; affx:startsAt "45256380" ; affx:stopsAt "45256475" ; affx:commonToAll "1" . :Gene532_e13 a affx:Exon ; affx:startsAt "45258999" ; affx:stopsAt "45259131" ; affx:commonToAll "1" . :Gene532_e14 a affx:Exon ; affx:startsAt "45261460" ; affx:stopsAt "45261617" ; affx:commonToAll "1" . :Gene532_e15 a affx:Exon ; affx:startsAt "45264176" ; affx:stopsAt "45264471" ; affx:commonToAll "1" . :Sgp1 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi881389] . :gi881389 a affx:Transcript ; affx:unigene "iMm.3363" ; affx:translatesTo "MYALALFASLLATALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAVKHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDMARVVAPFMSNIPLLLYPQDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKTNSSFIQGFVDHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMQPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN" ; affx:hasCds [affx:startsAt "60279303" ; affx:stopsAt "60303290" ]; affx:hasExon [ affx:relatesToExon :Sgp1_e1; affx:cdsType "Partial" ; affx:cdsStart "60279303" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Sgp1_e14; affx:cdsType "Partial" ; affx:cdsStop "60303290" ; affx:frame "1"] ; . :Sgp1_e1 a affx:Exon ; affx:startsAt "60279273" ; affx:stopsAt "60279343" ; affx:commonToAll "1" . :Sgp1_e2 a affx:Exon ; affx:startsAt "60293199" ; affx:stopsAt "60293333" ; affx:commonToAll "1" . :Sgp1_e3 a affx:Exon ; affx:startsAt "60294065" ; affx:stopsAt "60294140" ; affx:commonToAll "1" . :Sgp1_e4 a affx:Exon ; affx:startsAt "60294909" ; affx:stopsAt "60295035" ; affx:commonToAll "1" . :Sgp1_e5 a affx:Exon ; affx:startsAt "60296093" ; affx:stopsAt "60296291" ; affx:commonToAll "1" . :Sgp1_e6 a affx:Exon ; affx:startsAt "60296525" ; affx:stopsAt "60296669" ; affx:commonToAll "1" . :Sgp1_e7 a affx:Exon ; affx:startsAt "60297506" ; affx:stopsAt "60297563" ; affx:commonToAll "1" . :Sgp1_e8 a affx:Exon ; affx:startsAt "60300658" ; affx:stopsAt "60300790" ; affx:commonToAll "1" . :Sgp1_e9 a affx:Exon ; affx:startsAt "60301024" ; affx:stopsAt "60301120" ; affx:commonToAll "1" . :Sgp1_e10 a affx:Exon ; affx:startsAt "60301339" ; affx:stopsAt "60301619" ; affx:commonToAll "1" . :Sgp1_e11 a affx:Exon ; affx:startsAt "60301708" ; affx:stopsAt "60301866" ; affx:commonToAll "1" . :Sgp1_e12 a affx:Exon ; affx:startsAt "60302098" ; affx:stopsAt "60302179" ; affx:commonToAll "1" . :Sgp1_e13 a affx:Exon ; affx:startsAt "60302334" ; affx:stopsAt "60302442" ; affx:commonToAll "1" . :Sgp1_e14 a affx:Exon ; affx:startsAt "60303254" ; affx:stopsAt "60304159" ; affx:commonToAll "1" . :Gene534 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi4768904] ; affx:hasVariant [affx:representedBy :gi6755247] . :gi4768904 a affx:Transcript ; affx:unigene "iMm.3771" ; affx:translatesTo "MIIYRLKERLQLSLRQDKEKNQEIHLSPIARQQAQSEAKTTHSMVQPDQAPKVLNVVVDPQGQCTPEIRNSTSTSVCPSPFRMKPIGLQERRGSNVSLTLDMSSLGSVEPFVAVSTPREKVAMEYLQSASRVLTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNITDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVTGVTECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFESRLSPETVE" ; affx:hasCds [affx:startsAt "116403347" ; affx:stopsAt "116500788" ]; affx:hasExon [ affx:relatesToExon :Gene534_e5; affx:cdsType "Partial" ; affx:cdsStart "116403347" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene534_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene534_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene534_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e15; affx:cdsType "Partial" ; affx:cdsStop "116500788" ; affx:frame "1"] ; . :gi6755247 a affx:Transcript ; affx:unigene "iMm.3771" ; affx:translatesTo "MRRAVGFPALCLLLNLHAAGCFSRNNDHFLAIRQKKSWKPVFIYDHSQDIKKSLDIAQEAYKHNYHSPSEVQISKHHQIINSAFPRPAYDPSLNLLAESDQDLEIENLPIPAANVIVVTLQMDITKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKNQVELFVSPGNRKPGETQALQAEEVLRSLNVDGLHQSLPQFGITDVAPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFIIIVTCLMIIYRLKERLQLSLRQDKEKNQEIHLSPIARQQAQSEAKTTHSMVQPDQAPKVLNVVVDPQGQCTPEIRNSTSTSVCPSPFRMKPIGLQERRGSNVSLTLDMSSLGSVEPFVAVSTPREKVAMEYLQSASRVLTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNITDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVTGVTECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFESRLSPETVE" ; affx:hasCds [affx:startsAt "116243534" ; affx:stopsAt "116500788" ]; affx:hasExon [ affx:relatesToExon :Gene534_e1; affx:cdsType "Partial" ; affx:cdsStart "116243534" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene534_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene534_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene534_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene534_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene534_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene534_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene534_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene534_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene534_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene534_e16; affx:cdsType "Partial" ; affx:cdsStop "116500788" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "23" ; affx:spannedBy [ affx:startsAt "116243534" ; affx:stopsAt "116243592" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "116273178" ; affx:stopsAt "116273189" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "226" ; affx:stopsAt "248" ; affx:spannedBy [ affx:startsAt "116403293" ; affx:stopsAt "116403350" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "116413721" ; affx:stopsAt "116413730" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene534_e1 a affx:Exon ; affx:startsAt "116243178" ; affx:stopsAt "116243592" ; affx:commonToAll "0" . :Gene534_e2 a affx:Exon ; affx:startsAt "116273178" ; affx:stopsAt "116273474" ; affx:commonToAll "0" . :Gene534_e3 a affx:Exon ; affx:startsAt "116385939" ; affx:stopsAt "116386053" ; affx:commonToAll "0" . :Gene534_e4 a affx:Exon ; affx:startsAt "116387935" ; affx:stopsAt "116388091" ; affx:commonToAll "0" . :Gene534_e5 a affx:Exon ; affx:startsAt "116402947" ; affx:stopsAt "116403350" ; affx:commonToAll "0" . :Gene534_e6 a affx:Exon ; affx:startsAt "116403239" ; affx:stopsAt "116403350" ; affx:commonToAll "0" . :Gene534_e7 a affx:Exon ; affx:startsAt "116413721" ; affx:stopsAt "116413990" ; affx:commonToAll "1" . :Gene534_e8 a affx:Exon ; affx:startsAt "116452488" ; affx:stopsAt "116452675" ; affx:commonToAll "1" . :Gene534_e9 a affx:Exon ; affx:startsAt "116455489" ; affx:stopsAt "116455574" ; affx:commonToAll "1" . :Gene534_e10 a affx:Exon ; affx:startsAt "116462742" ; affx:stopsAt "116462822" ; affx:commonToAll "1" . :Gene534_e11 a affx:Exon ; affx:startsAt "116463294" ; affx:stopsAt "116463432" ; affx:commonToAll "1" . :Gene534_e12 a affx:Exon ; affx:startsAt "116477942" ; affx:stopsAt "116478053" ; affx:commonToAll "1" . :Gene534_e13 a affx:Exon ; affx:startsAt "116479649" ; affx:stopsAt "116479807" ; affx:commonToAll "1" . :Gene534_e14 a affx:Exon ; affx:startsAt "116482960" ; affx:stopsAt "116483074" ; affx:commonToAll "1" . :Gene534_e15 a affx:Exon ; affx:startsAt "116500694" ; affx:stopsAt "116501307" ; affx:commonToAll "0" . :Gene534_e16 a affx:Exon ; affx:startsAt "116500694" ; affx:stopsAt "116501891" ; affx:commonToAll "0" . :Prtn3 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi2105431] . :gi2105431 a affx:Transcript ; affx:unigene "iMm.2364" ; affx:translatesTo "MAGSYPSPKGIHPFLLLALVVGGAVQASKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLLLQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVTFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDWIQNVLRGAEP" ; affx:hasCds [affx:startsAt "80337010" ; affx:stopsAt "80340311" ]; affx:hasExon [ affx:relatesToExon :Prtn3_e1; affx:cdsType "Partial" ; affx:cdsStart "80337010" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Prtn3_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Prtn3_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Prtn3_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Prtn3_e5; affx:cdsType "Partial" ; affx:cdsStop "80340311" ; affx:frame "1"] ; . :Prtn3_e1 a affx:Exon ; affx:startsAt "80337001" ; affx:stopsAt "80337077" ; affx:commonToAll "1" . :Prtn3_e2 a affx:Exon ; affx:startsAt "80337762" ; affx:stopsAt "80337928" ; affx:commonToAll "1" . :Prtn3_e3 a affx:Exon ; affx:startsAt "80338370" ; affx:stopsAt "80338512" ; affx:commonToAll "1" . :Prtn3_e4 a affx:Exon ; affx:startsAt "80339269" ; affx:stopsAt "80339500" ; affx:commonToAll "1" . :Prtn3_e5 a affx:Exon ; affx:startsAt "80340152" ; affx:stopsAt "80340509" ; affx:commonToAll "1" . :Gene536 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi200496] . :gi200496 a affx:Transcript ; affx:unigene "iMm.1499" ; affx:translatesTo "MGGGSSPEAQQDSVMRTDSSEMTDVESVITSFASSARAGRRNALPDIQSSLATSGSSDLPLKLEALAVKEDAKTKNEEKDQGQPKTPLNEGK" ; affx:hasCds [affx:startsAt "57877815" ; affx:stopsAt "57906026" ]; affx:hasExon [ affx:relatesToExon :Gene536_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene536_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene536_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene536_e4; affx:cdsType "Partial" ; affx:cdsStart "57877815" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene536_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene536_e6; affx:cdsType "Partial" ; affx:cdsStop "57906026" ; affx:frame "1"] ; . :Gene536_e1 a affx:Exon ; affx:startsAt "57801634" ; affx:stopsAt "57801857" ; affx:commonToAll "1" . :Gene536_e2 a affx:Exon ; affx:startsAt "57821738" ; affx:stopsAt "57821831" ; affx:commonToAll "1" . :Gene536_e3 a affx:Exon ; affx:startsAt "57861806" ; affx:stopsAt "57861874" ; affx:commonToAll "1" . :Gene536_e4 a affx:Exon ; affx:startsAt "57877741" ; affx:stopsAt "57877849" ; affx:commonToAll "1" . :Gene536_e5 a affx:Exon ; affx:startsAt "57897758" ; affx:stopsAt "57897935" ; affx:commonToAll "1" . :Gene536_e6 a affx:Exon ; affx:startsAt "57905958" ; affx:stopsAt "57906750" ; affx:commonToAll "1" . :S100b a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6677838] . :gi6677838 a affx:Transcript ; affx:unigene "iMm.212672" ; affx:translatesTo "MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE" ; affx:hasCds [affx:startsAt "76693269" ; affx:stopsAt "76696303" ]; affx:hasExon [ affx:relatesToExon :S100b_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :S100b_e2; affx:cdsType "Full" ; affx:frame "1"] ; . :S100b_e1 a affx:Exon ; affx:startsAt "76693269" ; affx:stopsAt "76693407" ; affx:commonToAll "1" . :S100b_e2 a affx:Exon ; affx:startsAt "76696162" ; affx:stopsAt "76696303" ; affx:commonToAll "1" . :Prg a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6997242] . :gi6997242 a affx:Transcript ; affx:unigene "iMm.22194" ; affx:translatesTo "MQVPVGSRLVLALAFVLVWGSSVQGYPARRARYQWVRCKPNGFFANCIEEKGPQFDLIDESNNIGPPMNNPVLMEGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPEDDFII" ; affx:hasCds [affx:startsAt "62514079" ; affx:stopsAt "62527113" ]; affx:hasExon [ affx:relatesToExon :Prg_e1; affx:cdsType "Partial" ; affx:cdsStart "62514079" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Prg_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Prg_e3; affx:cdsType "Partial" ; affx:cdsStop "62527113" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "25" ; affx:spannedBy [ affx:startsAt "62527040" ; affx:stopsAt "62527113" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "62517235" ; affx:stopsAt "62517237" ; affx:inFrame "0" ] ; ] ; ] ; . :Prg_e1 a affx:Exon ; affx:startsAt "62513641" ; affx:stopsAt "62514320" ; affx:commonToAll "1" . :Prg_e2 a affx:Exon ; affx:startsAt "62517092" ; affx:stopsAt "62517237" ; affx:commonToAll "1" . :Prg_e3 a affx:Exon ; affx:startsAt "62527040" ; affx:stopsAt "62527154" ; affx:commonToAll "1" . :Gene539 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi200196] . :gi200196 a affx:Transcript ; affx:unigene "iMm.2903" ; affx:translatesTo "MEPFDPAELPELLKLYYRRLFPYAQYYRWLNYGGVTKNYFQHREFSFTLKDDIYIRYQSFNNQSELEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICSKCWTLMTMAMRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLNEKVHPFVRKSINIIKKYFEEYALVGQDILENKENWDKILALVPETIHDELQRGFQKFHSSPQRWEHLRKVANSSQNMKNDKCGPWLEWEVMLQYCFPRLDVNVSKGVNHLLKSPFSVHPKTGRISVPIDFHKVDQFDPFTVPTISAICRELDMVSTHEKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSDLQKDF" ; affx:hasCds [affx:startsAt "128678218" ; affx:stopsAt "128692757" ]; affx:hasExon [ affx:relatesToExon :Gene539_e1; affx:cdsType "Partial" ; affx:cdsStart "128678218" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene539_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene539_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene539_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene539_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene539_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene539_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene539_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene539_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene539_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene539_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene539_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene539_e13; affx:cdsType "Partial" ; affx:cdsStop "128692757" ; affx:frame "2"] ; . :Gene539_e1 a affx:Exon ; affx:startsAt "128678141" ; affx:stopsAt "128678321" ; affx:commonToAll "1" . :Gene539_e2 a affx:Exon ; affx:startsAt "128678932" ; affx:stopsAt "128679090" ; affx:commonToAll "1" . :Gene539_e3 a affx:Exon ; affx:startsAt "128680942" ; affx:stopsAt "128681049" ; affx:commonToAll "1" . :Gene539_e4 a affx:Exon ; affx:startsAt "128681114" ; affx:stopsAt "128681188" ; affx:commonToAll "1" . :Gene539_e5 a affx:Exon ; affx:startsAt "128683099" ; affx:stopsAt "128683236" ; affx:commonToAll "1" . :Gene539_e6 a affx:Exon ; affx:startsAt "128684642" ; affx:stopsAt "128684701" ; affx:commonToAll "1" . :Gene539_e7 a affx:Exon ; affx:startsAt "128685834" ; affx:stopsAt "128685944" ; affx:commonToAll "1" . :Gene539_e8 a affx:Exon ; affx:startsAt "128686554" ; affx:stopsAt "128686646" ; affx:commonToAll "1" . :Gene539_e9 a affx:Exon ; affx:startsAt "128686752" ; affx:stopsAt "128686891" ; affx:commonToAll "1" . :Gene539_e10 a affx:Exon ; affx:startsAt "128689489" ; affx:stopsAt "128689559" ; affx:commonToAll "1" . :Gene539_e11 a affx:Exon ; affx:startsAt "128690024" ; affx:stopsAt "128690110" ; affx:commonToAll "1" . :Gene539_e12 a affx:Exon ; affx:startsAt "128692157" ; affx:stopsAt "128692256" ; affx:commonToAll "1" . :Gene539_e13 a affx:Exon ; affx:startsAt "128692737" ; affx:stopsAt "128692955" ; affx:commonToAll "1" . :Gene540 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi17390484] . :gi17390484 a affx:Transcript ; affx:unigene "iMm.30226" ; affx:translatesTo "MAGKENNFPPLPPFLPLKPCFYQDFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLVACLAWWIAGGAGANFGLALLWLVLFTPCSYVCWFRPAYKAFRADSSFNFMTFFFIFGAQFVLTVIQAIGFSGWGACGWLAAVGFFGTSVGAAVVMLVPAILFSLSALVMAVTIVKVHRIYRGAGGSLQKAQTEWSAGTWRNPPSREAQFNSFSGNSLPEYPTVPSYSSSGGHWP" ; affx:hasCds [affx:startsAt "81079064" ; affx:stopsAt "81085006" ]; affx:hasExon [ affx:relatesToExon :Gene540_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene540_e2; affx:cdsType "Partial" ; affx:cdsStart "81079064" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene540_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene540_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene540_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene540_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene540_e7; affx:cdsType "Partial" ; affx:cdsStop "81085006" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "4" ; affx:containsMotif [ affx:startsAt "43" ; affx:stopsAt "65" ; affx:spannedBy [ affx:startsAt "81079672" ; affx:stopsAt "81079679" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "81079861" ; affx:stopsAt "81079920" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "71" ; affx:stopsAt "90" ; affx:spannedBy [ affx:startsAt "81079938" ; affx:stopsAt "81079995" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "103" ; affx:stopsAt "125" ; affx:spannedBy [ affx:startsAt "81081264" ; affx:stopsAt "81081330" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "145" ; affx:stopsAt "167" ; affx:spannedBy [ affx:startsAt "81082602" ; affx:stopsAt "81082668" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene540_e1 a affx:Exon ; affx:startsAt "81073133" ; affx:stopsAt "81073170" ; affx:commonToAll "1" . :Gene540_e2 a affx:Exon ; affx:startsAt "81079023" ; affx:stopsAt "81079071" ; affx:commonToAll "1" . :Gene540_e3 a affx:Exon ; affx:startsAt "81079550" ; affx:stopsAt "81079679" ; affx:commonToAll "1" . :Gene540_e4 a affx:Exon ; affx:startsAt "81079861" ; affx:stopsAt "81080018" ; affx:commonToAll "1" . :Gene540_e5 a affx:Exon ; affx:startsAt "81081248" ; affx:stopsAt "81081350" ; affx:commonToAll "1" . :Gene540_e6 a affx:Exon ; affx:startsAt "81082562" ; affx:stopsAt "81082680" ; affx:commonToAll "1" . :Gene540_e7 a affx:Exon ; affx:startsAt "81084826" ; affx:stopsAt "81086007" ; affx:commonToAll "1" . :Tnfaip3 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi6678376] . :gi6678376 a affx:Transcript ; affx:unigene "iMm.56971" ; affx:translatesTo "MAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIYHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRSVQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAACQYMWGVQDTDLVLRKALCSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLVKMASADTPAARSGLQYNSLEEIHIFVLSNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSQHFVPLVTLKDSGPELRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLIVMEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSDQARRAAHAQNPLEPSTPQLSLMDIKCETPNCPFFMSVNTQPLCHECSERRQKNQSKLPKLNSKLGPEGLPGVGLGSSNWSPEETAGGPHSAPPTAPSLFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHARQINASHTADPGKCQACLQDVTRTFNGICSTCFKRTTAEPSSSLTSSIPASCHQRSKSDPSQLIQSLTPHSCHRTGNVSPSGCLSQAARTPGDRAGTSKCRKAGCMYFGTPENKGFCTLCFIEYRENKQSVTASEKAGSPAPRFQNNVPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEARRTEEQLRSSQHRDMPRTTQVASRLKCARASCKNILACRSEELCMECQHLSQRVGSVAHRGEPTPEEPPKQRCRAPACDHFGNAKCNGYCNECYQFKQMYG" ; affx:hasCds [affx:startsAt "18882353" ; affx:stopsAt "18891398" ]; affx:hasExon [ affx:relatesToExon :Tnfaip3_e1; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tnfaip3_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tnfaip3_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tnfaip3_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tnfaip3_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tnfaip3_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tnfaip3_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tnfaip3_e8; affx:cdsType "Full" ; affx:frame "0"] ; . :Tnfaip3_e1 a affx:Exon ; affx:startsAt "18882353" ; affx:stopsAt "18882638" ; affx:commonToAll "1" . :Tnfaip3_e2 a affx:Exon ; affx:startsAt "18883198" ; affx:stopsAt "18883380" ; affx:commonToAll "1" . :Tnfaip3_e3 a affx:Exon ; affx:startsAt "18884079" ; affx:stopsAt "18884954" ; affx:commonToAll "1" . :Tnfaip3_e4 a affx:Exon ; affx:startsAt "18885173" ; affx:stopsAt "18885354" ; affx:commonToAll "1" . :Tnfaip3_e5 a affx:Exon ; affx:startsAt "18886485" ; affx:stopsAt "18886656" ; affx:commonToAll "1" . :Tnfaip3_e6 a affx:Exon ; affx:startsAt "18886804" ; affx:stopsAt "18886952" ; affx:commonToAll "1" . :Tnfaip3_e7 a affx:Exon ; affx:startsAt "18887767" ; affx:stopsAt "18887958" ; affx:commonToAll "1" . :Tnfaip3_e8 a affx:Exon ; affx:startsAt "18891103" ; affx:stopsAt "18891398" ; affx:commonToAll "1" . :MOR a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi15277133] ; affx:hasVariant [affx:representedBy :gi17046162] ; affx:hasVariant [affx:representedBy :gi17046164] ; affx:hasVariant [affx:representedBy :gi17046166] ; affx:hasVariant [affx:representedBy :gi17046168] ; affx:hasVariant [affx:representedBy :gi17046170] ; affx:hasVariant [affx:representedBy :gi17046172] ; affx:hasVariant [affx:representedBy :gi17046927] ; affx:hasVariant [affx:representedBy :gi18026690] ; affx:hasVariant [affx:representedBy :gi18026692] ; affx:hasVariant [affx:representedBy :gi18026694] ; affx:hasVariant [affx:representedBy :gi5805152] ; affx:hasVariant [affx:representedBy :gi6754939] ; affx:hasVariant [affx:representedBy :gi8778197] . :gi15277133 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQLENLEAETAPLP" ; affx:hasCds [affx:startsAt "6641088" ; affx:stopsAt "6702266" ]; affx:hasExon [ affx:relatesToExon :MOR_e5; affx:cdsType "Partial" ; affx:cdsStart "6641088" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :MOR_e17; affx:cdsType "Partial" ; affx:cdsStop "6702266" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "71" ; affx:stopsAt "93" ; affx:spannedBy [ affx:startsAt "6641301" ; affx:stopsAt "6641367" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "184" ; affx:stopsAt "206" ; affx:spannedBy [ affx:startsAt "6681160" ; affx:stopsAt "6681226" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "234" ; affx:stopsAt "256" ; affx:spannedBy [ affx:startsAt "6682049" ; affx:stopsAt "6682115" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "282" ; affx:stopsAt "301" ; affx:spannedBy [ affx:startsAt "6682193" ; affx:stopsAt "6682250" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "316" ; affx:stopsAt "338" ; affx:spannedBy [ affx:startsAt "6682295" ; affx:stopsAt "6682361" ; affx:inFrame "1" ] ; ] ; ] ; . :gi17046162 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MMEAFSKSAFQKLRQRDGNQEGKSYLRACPCKKLTEPRAAVRGRGWGAWNPNTLECSQLQPTESAASIQNHGQQRRPREHQRLL" ; affx:hasCds [affx:startsAt "6610620" ; affx:stopsAt "6641132" ]; affx:hasExon [ affx:relatesToExon :MOR_e2; affx:cdsType "Partial" ; affx:cdsStart "6610620" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e6; affx:cdsType "Partial" ; affx:cdsStop "6641132" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e15; affx:cdsType "None" ] ; . :gi17046164 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MMEAFSKSAFQKLRQRDGNQEGKSYLSLWIPHSPCSLPSTQRVALWGC" ; affx:hasCds [affx:startsAt "6610620" ; affx:stopsAt "6640850" ]; affx:hasExon [ affx:relatesToExon :MOR_e2; affx:cdsType "Partial" ; affx:cdsStart "6610620" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e4; affx:cdsType "Partial" ; affx:cdsStop "6640850" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e15; affx:cdsType "None" ] ; . :gi17046166 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MMEAFSKSAFQKLRQRDGNQEGKSYLRSCAGALLL" ; affx:hasCds [affx:startsAt "6610620" ; affx:stopsAt "6612490" ]; affx:hasExon [ affx:relatesToExon :MOR_e2; affx:cdsType "Partial" ; affx:cdsStart "6610620" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e3; affx:cdsType "Partial" ; affx:cdsStop "6612490" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e6; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e15; affx:cdsType "None" ] ; . :gi17046168 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MMEAFSKSAFQKLRQRDGNQEGKSYLRHLIPRKEIIFLKLK" ; affx:hasCds [affx:startsAt "6610620" ; affx:stopsAt "6677168" ]; affx:hasExon [ affx:relatesToExon :MOR_e2; affx:cdsType "Partial" ; affx:cdsStart "6610620" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e9; affx:cdsType "Partial" ; affx:cdsStop "6677168" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e15; affx:cdsType "None" ] ; . :gi17046170 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MMEAFSKSAFQKLRQRDGNQEGKSYLRLPLSILFLNKES" ; affx:hasCds [affx:startsAt "6610620" ; affx:stopsAt "6675853" ]; affx:hasExon [ affx:relatesToExon :MOR_e2; affx:cdsType "Partial" ; affx:cdsStart "6610620" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e8; affx:cdsType "Partial" ; affx:cdsStop "6675853" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e15; affx:cdsType "None" ] ; . :gi17046172 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MMEAFSKSAFQKLRQRDGNQEGKSYLRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQRNEEPSS" ; affx:hasCds [affx:startsAt "6610620" ; affx:stopsAt "6867377" ]; affx:hasExon [ affx:relatesToExon :MOR_e2; affx:cdsType "Partial" ; affx:cdsStart "6610620" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :MOR_e21; affx:cdsType "Partial" ; affx:cdsStop "6867377" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "4" ; affx:containsMotif [ affx:startsAt "116" ; affx:stopsAt "138" ; affx:spannedBy [ affx:startsAt "6681160" ; affx:stopsAt "6681226" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "166" ; affx:stopsAt "188" ; affx:spannedBy [ affx:startsAt "6682049" ; affx:stopsAt "6682115" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "214" ; affx:stopsAt "233" ; affx:spannedBy [ affx:startsAt "6682193" ; affx:stopsAt "6682250" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "248" ; affx:stopsAt "270" ; affx:spannedBy [ affx:startsAt "6682295" ; affx:stopsAt "6682361" ; affx:inFrame "1" ] ; ] ; ] ; . :gi17046927 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MMEAFSKSAFQKLRQRDGNQEGKSYLRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQLENLEAETAPLP" ; affx:hasCds [affx:startsAt "6610620" ; affx:stopsAt "6702266" ]; affx:hasExon [ affx:relatesToExon :MOR_e1; affx:cdsType "Partial" ; affx:cdsStart "6610620" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :MOR_e16; affx:cdsType "Partial" ; affx:cdsStop "6702266" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "4" ; affx:containsMotif [ affx:startsAt "116" ; affx:stopsAt "138" ; affx:spannedBy [ affx:startsAt "6681160" ; affx:stopsAt "6681226" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "166" ; affx:stopsAt "188" ; affx:spannedBy [ affx:startsAt "6682049" ; affx:stopsAt "6682115" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "214" ; affx:stopsAt "233" ; affx:spannedBy [ affx:startsAt "6682193" ; affx:stopsAt "6682250" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "248" ; affx:stopsAt "270" ; affx:spannedBy [ affx:startsAt "6682295" ; affx:stopsAt "6682361" ; affx:inFrame "1" ] ; ] ; ] ; . :gi18026690 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQVCAF" ; affx:hasCds [affx:startsAt "6641088" ; affx:stopsAt "6682520" ]; affx:hasExon [ affx:relatesToExon :MOR_e7; affx:cdsType "Partial" ; affx:cdsStart "6641088" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e12; affx:cdsType "Partial" ; affx:cdsStop "6682520" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "71" ; affx:stopsAt "93" ; affx:spannedBy [ affx:startsAt "6641301" ; affx:stopsAt "6641367" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "184" ; affx:stopsAt "206" ; affx:spannedBy [ affx:startsAt "6681160" ; affx:stopsAt "6681226" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "234" ; affx:stopsAt "256" ; affx:spannedBy [ affx:startsAt "6682049" ; affx:stopsAt "6682115" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "282" ; affx:stopsAt "301" ; affx:spannedBy [ affx:startsAt "6682193" ; affx:stopsAt "6682250" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "316" ; affx:stopsAt "338" ; affx:spannedBy [ affx:startsAt "6682295" ; affx:stopsAt "6682361" ; affx:inFrame "1" ] ; ] ; ] ; . :gi18026692 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKIDLF" ; affx:hasCds [affx:startsAt "6641088" ; affx:stopsAt "6693302" ]; affx:hasExon [ affx:relatesToExon :MOR_e7; affx:cdsType "Partial" ; affx:cdsStart "6641088" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :MOR_e14; affx:cdsType "Partial" ; affx:cdsStop "6693302" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "71" ; affx:stopsAt "93" ; affx:spannedBy [ affx:startsAt "6641301" ; affx:stopsAt "6641367" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "184" ; affx:stopsAt "206" ; affx:spannedBy [ affx:startsAt "6681160" ; affx:stopsAt "6681226" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "234" ; affx:stopsAt "256" ; affx:spannedBy [ affx:startsAt "6682049" ; affx:stopsAt "6682115" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "282" ; affx:stopsAt "301" ; affx:spannedBy [ affx:startsAt "6682193" ; affx:stopsAt "6682250" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "316" ; affx:stopsAt "338" ; affx:spannedBy [ affx:startsAt "6682295" ; affx:stopsAt "6682361" ; affx:inFrame "1" ] ; ] ; ] ; . :gi18026694 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKLLMWRAMPTFKRHLAIMLSLDN" ; affx:hasCds [affx:startsAt "6641088" ; affx:stopsAt "6692663" ]; affx:hasExon [ affx:relatesToExon :MOR_e7; affx:cdsType "Partial" ; affx:cdsStart "6641088" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :MOR_e13; affx:cdsType "Partial" ; affx:cdsStop "6692663" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "71" ; affx:stopsAt "93" ; affx:spannedBy [ affx:startsAt "6641301" ; affx:stopsAt "6641367" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "184" ; affx:stopsAt "206" ; affx:spannedBy [ affx:startsAt "6681160" ; affx:stopsAt "6681226" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "234" ; affx:stopsAt "256" ; affx:spannedBy [ affx:startsAt "6682049" ; affx:stopsAt "6682115" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "282" ; affx:stopsAt "301" ; affx:spannedBy [ affx:startsAt "6682193" ; affx:stopsAt "6682250" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "316" ; affx:stopsAt "338" ; affx:spannedBy [ affx:startsAt "6682295" ; affx:stopsAt "6682361" ; affx:inFrame "1" ] ; ] ; ] ; . :gi5805152 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQRNEEPSS" ; affx:hasCds [affx:startsAt "6641088" ; affx:stopsAt "6867377" ]; affx:hasExon [ affx:relatesToExon :MOR_e7; affx:cdsType "Partial" ; affx:cdsStart "6641088" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :MOR_e21; affx:cdsType "Partial" ; affx:cdsStop "6867377" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "71" ; affx:stopsAt "93" ; affx:spannedBy [ affx:startsAt "6641301" ; affx:stopsAt "6641367" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "184" ; affx:stopsAt "206" ; affx:spannedBy [ affx:startsAt "6681160" ; affx:stopsAt "6681226" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "234" ; affx:stopsAt "256" ; affx:spannedBy [ affx:startsAt "6682049" ; affx:stopsAt "6682115" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "282" ; affx:stopsAt "301" ; affx:spannedBy [ affx:startsAt "6682193" ; affx:stopsAt "6682250" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "316" ; affx:stopsAt "338" ; affx:spannedBy [ affx:startsAt "6682295" ; affx:stopsAt "6682361" ; affx:inFrame "1" ] ; ] ; ] ; . :gi6754939 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKKKLDSQRGCVQHPV" ; affx:hasCds [affx:startsAt "6641088" ; affx:stopsAt "6825556" ]; affx:hasExon [ affx:relatesToExon :MOR_e7; affx:cdsType "Partial" ; affx:cdsStart "6641088" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :MOR_e19; affx:cdsType "Partial" ; affx:cdsStop "6825556" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e20; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e21; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "71" ; affx:stopsAt "93" ; affx:spannedBy [ affx:startsAt "6641301" ; affx:stopsAt "6641367" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "184" ; affx:stopsAt "206" ; affx:spannedBy [ affx:startsAt "6681160" ; affx:stopsAt "6681226" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "234" ; affx:stopsAt "256" ; affx:spannedBy [ affx:startsAt "6682049" ; affx:stopsAt "6682115" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "282" ; affx:stopsAt "301" ; affx:spannedBy [ affx:startsAt "6682193" ; affx:stopsAt "6682250" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "316" ; affx:stopsAt "338" ; affx:spannedBy [ affx:startsAt "6682295" ; affx:stopsAt "6682361" ; affx:inFrame "1" ] ; ] ; ] ; . :gi8778197 a affx:Transcript ; affx:unigene "iMm.4191" ; affx:translatesTo "MDSSAGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQAPCACMPGANRGQTKASDLLDLELKTVGSHQADAETNPGPYEGSKCAEPLAISLVPLH" ; affx:hasCds [affx:startsAt "6641088" ; affx:stopsAt "6760283" ]; affx:hasExon [ affx:relatesToExon :MOR_e7; affx:cdsType "Partial" ; affx:cdsStart "6641088" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MOR_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :MOR_e18; affx:cdsType "Partial" ; affx:cdsStop "6760254" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :MOR_e19; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e20; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :MOR_e21; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "71" ; affx:stopsAt "93" ; affx:spannedBy [ affx:startsAt "6641301" ; affx:stopsAt "6641367" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "184" ; affx:stopsAt "206" ; affx:spannedBy [ affx:startsAt "6681160" ; affx:stopsAt "6681226" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "234" ; affx:stopsAt "256" ; affx:spannedBy [ affx:startsAt "6682049" ; affx:stopsAt "6682115" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "282" ; affx:stopsAt "301" ; affx:spannedBy [ affx:startsAt "6682193" ; affx:stopsAt "6682250" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "316" ; affx:stopsAt "338" ; affx:spannedBy [ affx:startsAt "6682295" ; affx:stopsAt "6682361" ; affx:inFrame "1" ] ; ] ; ] ; . :MOR_e1 a affx:Exon ; affx:startsAt "6610515" ; affx:stopsAt "6610700" ; affx:commonToAll "0" . :MOR_e2 a affx:Exon ; affx:startsAt "6610602" ; affx:stopsAt "6610700" ; affx:commonToAll "0" . :MOR_e3 a affx:Exon ; affx:startsAt "6612462" ; affx:stopsAt "6612591" ; affx:commonToAll "0" . :MOR_e4 a affx:Exon ; affx:startsAt "6640783" ; affx:stopsAt "6641372" ; affx:commonToAll "0" . :MOR_e5 a affx:Exon ; affx:startsAt "6640874" ; affx:stopsAt "6641372" ; affx:commonToAll "0" . :MOR_e6 a affx:Exon ; affx:startsAt "6640957" ; affx:stopsAt "6641372" ; affx:commonToAll "0" . :MOR_e7 a affx:Exon ; affx:startsAt "6641022" ; affx:stopsAt "6641372" ; affx:commonToAll "0" . :MOR_e8 a affx:Exon ; affx:startsAt "6675813" ; affx:stopsAt "6675921" ; affx:commonToAll "0" . :MOR_e9 a affx:Exon ; affx:startsAt "6677122" ; affx:stopsAt "6677271" ; affx:commonToAll "0" . :MOR_e10 a affx:Exon ; affx:startsAt "6680892" ; affx:stopsAt "6681245" ; affx:commonToAll "1" . :MOR_e11 a affx:Exon ; affx:startsAt "6681984" ; affx:stopsAt "6682505" ; affx:commonToAll "0" . :MOR_e12 a affx:Exon ; affx:startsAt "6681984" ; affx:stopsAt "6682647" ; affx:commonToAll "0" . :MOR_e13 a affx:Exon ; affx:startsAt "6692591" ; affx:stopsAt "6693406" ; affx:commonToAll "0" . :MOR_e14 a affx:Exon ; affx:startsAt "6693284" ; affx:stopsAt "6693406" ; affx:commonToAll "0" . :MOR_e15 a affx:Exon ; affx:startsAt "6702227" ; affx:stopsAt "6702280" ; affx:commonToAll "0" . :MOR_e16 a affx:Exon ; affx:startsAt "6702227" ; affx:stopsAt "6702400" ; affx:commonToAll "0" . :MOR_e17 a affx:Exon ; affx:startsAt "6702227" ; affx:stopsAt "6702994" ; affx:commonToAll "0" . :MOR_e18 a affx:Exon ; affx:startsAt "6760105" ; affx:stopsAt "6760292" ; affx:commonToAll "0" . :MOR_e19 a affx:Exon ; affx:startsAt "6825508" ; affx:stopsAt "6825628" ; affx:commonToAll "0" . :MOR_e20 a affx:Exon ; affx:startsAt "6832926" ; affx:stopsAt "6833015" ; affx:commonToAll "0" . :MOR_e21 a affx:Exon ; affx:startsAt "6867353" ; affx:stopsAt "6867421" ; affx:commonToAll "0" . :TLP21 a affx:Gene ; affx:strand "-" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi4218069] . :gi4218069 a affx:Transcript ; affx:unigene "iMm.28415" ; affx:translatesTo "MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL" ; affx:hasCds [affx:startsAt "22655828" ; affx:stopsAt "22662061" ]; affx:hasExon [ affx:relatesToExon :TLP21_e1; affx:cdsType "Partial" ; affx:cdsStart "22655828" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :TLP21_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :TLP21_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :TLP21_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :TLP21_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :TLP21_e6; affx:cdsType "Partial" ; affx:cdsStop "22662061" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :TLP21_e7; affx:cdsType "None" ] ; . :TLP21_e1 a affx:Exon ; affx:startsAt "22655388" ; affx:stopsAt "22655908" ; affx:commonToAll "1" . :TLP21_e2 a affx:Exon ; affx:startsAt "22657601" ; affx:stopsAt "22657696" ; affx:commonToAll "1" . :TLP21_e3 a affx:Exon ; affx:startsAt "22657783" ; affx:stopsAt "22657887" ; affx:commonToAll "1" . :TLP21_e4 a affx:Exon ; affx:startsAt "22659158" ; affx:stopsAt "22659222" ; affx:commonToAll "1" . :TLP21_e5 a affx:Exon ; affx:startsAt "22659369" ; affx:stopsAt "22659452" ; affx:commonToAll "1" . :TLP21_e6 a affx:Exon ; affx:startsAt "22661926" ; affx:stopsAt "22662104" ; affx:commonToAll "1" . :TLP21_e7 a affx:Exon ; affx:startsAt "22681128" ; affx:stopsAt "22681340" ; affx:commonToAll "1" . :Tle2 a affx:Gene ; affx:strand "+" ; affx:chr "chr10" ; affx:hasVariant [affx:representedBy :gi9789970] . :gi9789970 a affx:Transcript ; affx:unigene "iMm.38608" ; affx:translatesTo "MYPQGRHPTPLQSGQPFKFSVLEICDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMAAPHQCPQGGTSYPHWPRLSPLQYYEMSYGLNIEMHKQAEIVKRLSAICAQMVPFLTQEHQQQVLQAVDRAKQVTVGELNSLLGQQNQLQPLSHAPPVPLTPRPAGLVGAGATGLLALSGALAAQAQLVAAVKEDRVGVDAEGSRVDRAASRSSSPSPPESLVEEDHPSSRGGSGKQQRAEDKDLSGPYDSEEDKSDYNLVVDEDQPSEPPSPVTTPCGKAPLCIPARRDLTDSPA