# Test data in notation3 http://www.w3.org/DesignIssues/Notation3.html # @prefix affx: . @prefix rdfs: . @prefix owl: . @prefix : <#> . affx:Gene a owl:Class ; owl:hasProperty affx:onStrand ; owl:hasProperty affx:onChr ; owl:hasProperty affx:hasVariant . affx:onStrand a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The strand on which the gene exists" . affx:onChr a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The chromosome on which the gene exists" . affx:hasVariant a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range affx:SpliceVariant ; owl:minCardinality "1" ; rdfs:comment "For associating variants to genes" . affx:SpliceVariant a owl:Class ; owl:hasProperty affx:representedBy . affx:representedBy a owl:ObjectProperty ; owl:domain affx:SpliceVariant ; owl:range affx:Transcript ; owl:minCardinality "1" ; rdfs:comment "In this data, each splice variant is represented by one transcript" . affx:Transcript a owl:Class ; owl:hasProperty affx:unigene ; owl:hasProperty affx:translatesTo ; owl:hasProperty affx:fullCds ; owl:hasProperty affx:hasExon ; owl:hasProperty affx:signalPHit ; owl:hasProperty affx:tmHMMHit ; rdfs:comment "A transcript has a CDS region, a protein translation, and exons" ; rdfs:comment "Additionally the transcript might have one or more annotations" . affx:unigene a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The Unigene ID of the transcript - and splice variant" . affx:translatesTo a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The amino acid sequence derived from the transcript" . affx:fullCds a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:GenomicCoordinates ; owl:cardinality "1" ; rdfs:comment "Start and stop coordinates of the full CDS region" . affx:hasExon a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:ExonPlusCds ; owl:minCardinality "1" ; rdfs:comment "Here, exons are defined only by their coordinates " . affx:ExonPlusCds a owl:Class ; owl:hasProperty affx:relatesToExon ; owl:hasProperty affx:cdsType ; owl:hasProperty affx:cdsStart ; owl:hasProperty affx:cdsStop ; owl:hasProperty affx:frame . affx:relatesToExon a owl:ObjectProperty ; owl:domain affx:ExonWithCds ; owl:range affx:Exon ; owl:cardinality "1" ; rdfs:comment "For associating exons with properties such as frame" . affx:Exon a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:commonToAll ; rdfs:comment "Defines the coordinates of an exon on the genome" . affx:GenomicSpan a owl:Class ; rdfs:subClassOf affx:GenomicCoordinates ; rdfs:comment "This defines a region of _ungapped_ genomic alignment" . affx:GenomicCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Start and stop, possibly with intervening gaps " ; rdfs:comment "Strand and chr will be specified at the gene level " . affx:Coordinates a owl:Class ; owl:hasProperty affx:startsAt ; owl:hasProperty affx:stopsAt . affx:startsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:stopsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:cdsType a owl:ObjectProperty ; owl:domain affx:ExonPlusCds ; owl:range rdfs:Literal ; rdfs:comment "Expected CDS types are Full, Partial, and None" . affx:commonToAll a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Shows if all the gene's variants share this object" . affx:CdsOccupancy a owl:Class ; rdfs:subClassOf rdfs:Literal . affx:cdsStart a owl:ObjectProperty ; rdfs:subClassOf affx:startsAt ; rdfs:comment "For indicating where a specific CDS region starts" . affx:cdsStop a owl:ObjectProperty ; rdfs:subClassOf affx:stopsAt ; rdfs:comment "For indicating where a specific CDS region stops" . affx:frame a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" . affx:signalPHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:SignalPeptide ; owl:cardinality "1" . affx:SignalPeptide a owl:Class ; rdfs:subClassOf affx:Annotation ; rdfs:comment "Represents a SIGNALP hit" . affx:tmHMMHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:Transmembrane ; owl:cardinality "1" . affx:Transmembrane a owl:Class ; rdfs:subClassOf affx:Annotation ; owl:hasProperty affx:helixCount ; rdfs:comment "Represents a TMHMM hit" . affx:Annotation a owl:Class ; owl:hasProperty affx:containsMotif; owl:hasProperty affx:commonToAll ; owl:hasProperty affx:motifCount . affx:containsMotif a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range affx:Motif ; owl:minCardinality "1" . affx:motifCount a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Number of motifs (eg. TM passes) in this annotation" . affx:Motif a owl:Class ; owl:hasProperty affx:hasProteinSpan . affx:hasProteinSpan a owl:ObjectProperty ; owl:domain affx:Motif ; owl:range affx:ProteinSpan . affx:ProteinCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Coordinates onto the protein sequence, possibly gapped ". affx:spannedBy a owl:ObjectProperty ; owl:domain affx:ProteinSpan ; owl:range affx:CdsSpan ; owl:minCardinality "1" . affx:ProteinSpan a owl:Class ; rdfs:subClassOf affx:ProteinCoordinates ; owl:hasProperty affx:spannedBy ; rdfs:comment "An ungapped region of the protein sequence " ; rdfs:comment "Each ProteinSpan as one or more corresponding CDS span" . affx:CdsSpan a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:inFrame ; rdfs:comment "A CDS span is a genomic span with a translation frame" ; rdfs:comment "Each CDS span describes a part of the full CDS region" . :Gene5851 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi14919439] . :gi14919439 a affx:Transcript ; affx:unigene "iMm.28585" ; affx:translatesTo "MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL" ; affx:hasCds [affx:startsAt "87159583" ; affx:stopsAt "87160036" ]; affx:hasExon [ affx:relatesToExon :Gene5851_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5851_e2; affx:cdsType "Partial" ; affx:cdsStart "87159583" ; affx:cdsStop "87160036" ; affx:frame "2"] ; . :Gene5851_e1 a affx:Exon ; affx:startsAt "87155489" ; affx:stopsAt "87156048" ; affx:commonToAll "1" . :Gene5851_e2 a affx:Exon ; affx:startsAt "87159564" ; affx:stopsAt "87160043" ; affx:commonToAll "1" . :Gene5852 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi14250234] . :gi14250234 a affx:Transcript ; affx:unigene "iMm.77445" ; affx:translatesTo "MAVVDVSTVFKELVVFRDVAVEFCKEEWECLGPEQRSLYRDVMLENYSNFVSLGLAISKPSIISLLEQGKEPWIVEQAGWCPDLLSVNEAKSLSLKNGIFGKESLKWKIIERVGSSCLEESCFGDDWKCKGLLETKRESTEEYLQGVTDPLEETSARFVQPAPIALSEVTHSETKLSEQDAGETITQQVRIPTSDKLNEMYENAFIYYTGEMKRQQDFAGDRCDELKACSRGFAYDFQLAPYQINKKPYQCEICGKIFEKHAYLVQHNRFHTGEKPCECKECGKAFTNCSLLVQHQRVHTDEKPYECKHCGKAFLYFSTFFQHQRTHTNEKPYECHKCQKAFNKSANLTRHQRIHSGEKPYECNLCGKTFTWASNLNDHQKIHTGEKPYECNYCEKAFLCHSAFMKHYRTHTNEKPYECQECMKAFRQKAHLIQHQRVHTGEKPYECKECGKAFACPSYFNRHQRIHTGERPYECKECGKAFIDCKTLILHQRIHTGEKPFQCQQCSKAFRQRSHLTQHQRIHTGEKPYECKECGQAFTRLLQVKKHQRVHTVGEILCI" ; affx:hasCds [affx:startsAt "22049067" ; affx:stopsAt "22055261" ]; affx:hasExon [ affx:relatesToExon :Gene5852_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5852_e2; affx:cdsType "Partial" ; affx:cdsStart "22049067" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5852_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5852_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5852_e5; affx:cdsType "Partial" ; affx:cdsStop "22055261" ; affx:frame "2"] ; . :Gene5852_e1 a affx:Exon ; affx:startsAt "22046300" ; affx:stopsAt "22046392" ; affx:commonToAll "1" . :Gene5852_e2 a affx:Exon ; affx:startsAt "22049035" ; affx:stopsAt "22049100" ; affx:commonToAll "1" . :Gene5852_e3 a affx:Exon ; affx:startsAt "22053034" ; affx:stopsAt "22053161" ; affx:commonToAll "1" . :Gene5852_e4 a affx:Exon ; affx:startsAt "22053601" ; affx:stopsAt "22053688" ; affx:commonToAll "1" . :Gene5852_e5 a affx:Exon ; affx:startsAt "22053828" ; affx:stopsAt "22055660" ; affx:commonToAll "1" . :Gene5853 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi14250240] . :gi14250240 a affx:Transcript ; affx:unigene "iMm.42855" ; affx:translatesTo "MVRPRRAPHRSGAGGPLGGRGRPPRPLVVRAVRSRSWPGGPRGPQPPRIRARSAPPMEGARVFGALGPIGPSSPGLTLGGLAVNEHRLSNKLLAWSGVLEWQEKRRPFSDSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNAIRQVITTRKQAVGPGGVHSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTDQWPRRLFMQLIPQQLLTTLVPLFRNSRLVQFHFTKDMETLKSLCRIMDNGFAGCVHFSYKASCEVRVLMLLYSSEKKIFIGLIPHDQSNFVNGIRRVIANQQQVLQRSLEQEQQQRGMGG" ; affx:hasCds [affx:startsAt "34429632" ; affx:stopsAt "34435781" ]; affx:hasExon [ affx:relatesToExon :Gene5853_e1; affx:cdsType "Partial" ; affx:cdsStart "34429632" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5853_e12; affx:cdsType "Partial" ; affx:cdsStop "34435781" ; affx:frame "2"] ; . :Gene5853_e1 a affx:Exon ; affx:startsAt "34429267" ; affx:stopsAt "34429644" ; affx:commonToAll "1" . :Gene5853_e2 a affx:Exon ; affx:startsAt "34429734" ; affx:stopsAt "34429932" ; affx:commonToAll "1" . :Gene5853_e3 a affx:Exon ; affx:startsAt "34430642" ; affx:stopsAt "34430747" ; affx:commonToAll "1" . :Gene5853_e4 a affx:Exon ; affx:startsAt "34430871" ; affx:stopsAt "34430929" ; affx:commonToAll "1" . :Gene5853_e5 a affx:Exon ; affx:startsAt "34431021" ; affx:stopsAt "34431095" ; affx:commonToAll "1" . :Gene5853_e6 a affx:Exon ; affx:startsAt "34431172" ; affx:stopsAt "34431262" ; affx:commonToAll "1" . :Gene5853_e7 a affx:Exon ; affx:startsAt "34431731" ; affx:stopsAt "34431887" ; affx:commonToAll "1" . :Gene5853_e8 a affx:Exon ; affx:startsAt "34433069" ; affx:stopsAt "34433177" ; affx:commonToAll "1" . :Gene5853_e9 a affx:Exon ; affx:startsAt "34433319" ; affx:stopsAt "34433377" ; affx:commonToAll "1" . :Gene5853_e10 a affx:Exon ; affx:startsAt "34433452" ; affx:stopsAt "34433535" ; affx:commonToAll "1" . :Gene5853_e11 a affx:Exon ; affx:startsAt "34433634" ; affx:stopsAt "34433772" ; affx:commonToAll "1" . :Gene5853_e12 a affx:Exon ; affx:startsAt "34435610" ; affx:stopsAt "34435924" ; affx:commonToAll "1" . :Gene5854 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi14714608] . :gi14714608 a affx:Transcript ; affx:unigene "iMm.41608" ; affx:translatesTo "MCRTEVHSDCRHEKEGKRPREETKATKKILSPEAGPMEPRPSFASPSCNLELLFKNSQQGHPTVAVHNPILKADQRHGCHVCGKSFAHQSKLVEHLYTHTGEKPFQCPDCDKYFGRASSLSMHRAIHRGERPHQCPDCGKSFTQRSTLVAHMYTHTGEKPFHCPDCNKSFSRPSSLSSHRAIHRGERPHCCSDCGRAFTHRSGLIAHLRVHTGEKPYCCADCGRCFSQSSGLREHQRVVHSGVTPFTCTHCGRAFARAAYLQCHMRTHTGEKPYSCPDCGRCFRQSSDMAAHRRTHSGERPYPCPQCGRRFPTKSAVTKHQWVHRPGAKGHKDKKFSQLSISLDPSQEDPDPPVGFQHYPEIFQECGGWS" ; affx:hasCds [affx:startsAt "117247410" ; affx:stopsAt "117249008" ]; affx:hasExon [ affx:relatesToExon :Gene5854_e1; affx:cdsType "Partial" ; affx:cdsStart "117247410" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5854_e2; affx:cdsType "Partial" ; affx:cdsStop "117249008" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5854_e3; affx:cdsType "None" ] ; . :Gene5854_e1 a affx:Exon ; affx:startsAt "117246910" ; affx:stopsAt "117248498" ; affx:commonToAll "1" . :Gene5854_e2 a affx:Exon ; affx:startsAt "117248983" ; affx:stopsAt "117249097" ; affx:commonToAll "1" . :Gene5854_e3 a affx:Exon ; affx:startsAt "117249235" ; affx:stopsAt "117249602" ; affx:commonToAll "1" . :Gene5855 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi14318733] . :gi14318733 a affx:Transcript ; affx:unigene "iMm.4050" ; affx:translatesTo "MEQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVHLMPALVQRRIADYEAASAAPGIPAEQTRDSPSGS" ; affx:hasCds [affx:startsAt "95410016" ; affx:stopsAt "95410628" ]; affx:hasExon [ affx:relatesToExon :Gene5855_e1; affx:cdsType "Partial" ; affx:cdsStart "95410016" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5855_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5855_e3; affx:cdsType "Partial" ; affx:cdsStop "95410628" ; affx:frame "2"] ; . :Gene5855_e1 a affx:Exon ; affx:startsAt "95409963" ; affx:stopsAt "95410046" ; affx:commonToAll "1" . :Gene5855_e2 a affx:Exon ; affx:startsAt "95410185" ; affx:stopsAt "95410281" ; affx:commonToAll "1" . :Gene5855_e3 a affx:Exon ; affx:startsAt "95410451" ; affx:stopsAt "95411270" ; affx:commonToAll "1" . :Gene5856 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13543132] . :gi13543132 a affx:Transcript ; affx:unigene "iMm.21289" ; affx:translatesTo "MDMNSIKEPQSRLRKWTTVDSMSVNTSLDQNSSKHGAISSGFRLEESPFVPYDFMNSSTSPASPPGSIGDGWPRAKSPNGSSSVNWPPEFRPGEPWKGYPNIDPETDPYVTPGSVINSLSINTVREVDHLRDRNSGSSSSLNTTLPSTSAWSSIRASNYNVPLSSTAQSTSARNSDSKLTWSPGSVTNTSLAHELWKVPLPPKNITAPSRPPPGLTGQKPPLSTWDNSPLRVGGGWGNSDARYTPGSSWGESSSGRITNWLVLKNLTPQIDGSTLRTLCMQHGPLITFHLNLPHGNALVRYSSKEEVVKAQKSLHMCVLGNTTILAEFASEEEISRFFAQSQSLTPSPGWQSLGSSQSRLGSLDCSHSFSSRTDVNHWNGAGLSGANCGDLHGTSLWGTPHYSTSLWGPPSSDPRGISSPSPINAFLSVDHLLFLFVFFAKPFWG" ; affx:hasCds [affx:startsAt "113023070" ; affx:stopsAt "113032196" ]; affx:hasExon [ affx:relatesToExon :Gene5856_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5856_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5856_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5856_e4; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5856_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5856_e6; affx:cdsType "Partial" ; affx:cdsStart "113023070" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5856_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5856_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5856_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5856_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5856_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5856_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5856_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5856_e14; affx:cdsType "Partial" ; affx:cdsStop "113032196" ; affx:frame "2"] ; . :Gene5856_e1 a affx:Exon ; affx:startsAt "113018678" ; affx:stopsAt "113018748" ; affx:commonToAll "1" . :Gene5856_e2 a affx:Exon ; affx:startsAt "113019428" ; affx:stopsAt "113019566" ; affx:commonToAll "1" . :Gene5856_e3 a affx:Exon ; affx:startsAt "113020207" ; affx:stopsAt "113020336" ; affx:commonToAll "1" . :Gene5856_e4 a affx:Exon ; affx:startsAt "113020844" ; affx:stopsAt "113020922" ; affx:commonToAll "1" . :Gene5856_e5 a affx:Exon ; affx:startsAt "113021134" ; affx:stopsAt "113021342" ; affx:commonToAll "1" . :Gene5856_e6 a affx:Exon ; affx:startsAt "113023044" ; affx:stopsAt "113023176" ; affx:commonToAll "1" . :Gene5856_e7 a affx:Exon ; affx:startsAt "113025451" ; affx:stopsAt "113025610" ; affx:commonToAll "1" . :Gene5856_e8 a affx:Exon ; affx:startsAt "113026241" ; affx:stopsAt "113026382" ; affx:commonToAll "1" . :Gene5856_e9 a affx:Exon ; affx:startsAt "113027676" ; affx:stopsAt "113027784" ; affx:commonToAll "1" . :Gene5856_e10 a affx:Exon ; affx:startsAt "113028733" ; affx:stopsAt "113028955" ; affx:commonToAll "1" . :Gene5856_e11 a affx:Exon ; affx:startsAt "113030388" ; affx:stopsAt "113030459" ; affx:commonToAll "1" . :Gene5856_e12 a affx:Exon ; affx:startsAt "113030947" ; affx:stopsAt "113031087" ; affx:commonToAll "1" . :Gene5856_e13 a affx:Exon ; affx:startsAt "113031467" ; affx:stopsAt "113031813" ; affx:commonToAll "1" . :Gene5856_e14 a affx:Exon ; affx:startsAt "113032151" ; affx:stopsAt "113032656" ; affx:commonToAll "1" . :Gene5857 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13938125] . :gi13938125 a affx:Transcript ; affx:unigene "iMm.147529" ; affx:translatesTo "MVSIPEYYEGKNILLTGATGFLGKVLLEKLLRSCPRVNSVYVLVRQKAGQTPQERVEEILSSKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEIIIDSTNVIFHCAATVRFNENLRDAVQLNVIATRQLILLAQQMKNLEVFMHVSTAYAYCNRKHIDEVVYPPPVDPKKLIDSLEWMDDGLVNDITPKLIGDRPNTYIYTKALAEYVVQQEGAKLNVAIVRPSIVGASWKEPFPGWIDNFNGPSGLFIAAGKGILRTMRASNNALADLVPVDVVVNTSLAAAWYSGVNRPRNIMVYNCTTGSTNPFHWGEVEYHVISTFKRNPLEQAFRRPNVNLTSNHLLYHYWIAVSHKAPAFLYDIYLRMTGRSPRMMKTITRLHKAMVFLEYFTSNSWVWNTDNVNMLMNQLNPEDKKTFNIDVRQLHWAEYIENYCMGTKKYVLNEEMSGLPAARKHLNKLRNIRYGFNTILVILIWRIFIARSQMARNIWYFVVSLCYKFLSYFRASSTMRY" ; affx:hasCds [affx:startsAt "103152644" ; affx:stopsAt "103181624" ]; affx:hasExon [ affx:relatesToExon :Gene5857_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5857_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5857_e3; affx:cdsType "Partial" ; affx:cdsStart "103152644" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5857_e13; affx:cdsType "Partial" ; affx:cdsStop "103181624" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "466" ; affx:stopsAt "483" ; affx:spannedBy [ affx:startsAt "103181474" ; affx:stopsAt "103181525" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene5857_e1 a affx:Exon ; affx:startsAt "103127249" ; affx:stopsAt "103127301" ; affx:commonToAll "1" . :Gene5857_e2 a affx:Exon ; affx:startsAt "103139351" ; affx:stopsAt "103139402" ; affx:commonToAll "1" . :Gene5857_e3 a affx:Exon ; affx:startsAt "103152639" ; affx:stopsAt "103152833" ; affx:commonToAll "1" . :Gene5857_e4 a affx:Exon ; affx:startsAt "103153902" ; affx:stopsAt "103154078" ; affx:commonToAll "1" . :Gene5857_e5 a affx:Exon ; affx:startsAt "103160768" ; affx:stopsAt "103160948" ; affx:commonToAll "1" . :Gene5857_e6 a affx:Exon ; affx:startsAt "103163332" ; affx:stopsAt "103163510" ; affx:commonToAll "1" . :Gene5857_e7 a affx:Exon ; affx:startsAt "103164439" ; affx:stopsAt "103164484" ; affx:commonToAll "1" . :Gene5857_e8 a affx:Exon ; affx:startsAt "103164601" ; affx:stopsAt "103164720" ; affx:commonToAll "1" . :Gene5857_e9 a affx:Exon ; affx:startsAt "103165301" ; affx:stopsAt "103165369" ; affx:commonToAll "1" . :Gene5857_e10 a affx:Exon ; affx:startsAt "103167008" ; affx:stopsAt "103167180" ; affx:commonToAll "1" . :Gene5857_e11 a affx:Exon ; affx:startsAt "103174742" ; affx:stopsAt "103174872" ; affx:commonToAll "1" . :Gene5857_e12 a affx:Exon ; affx:startsAt "103179751" ; affx:stopsAt "103179879" ; affx:commonToAll "1" . :Gene5857_e13 a affx:Exon ; affx:startsAt "103181461" ; affx:stopsAt "103183164" ; affx:commonToAll "1" . :Gene5858 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13938638] . :gi13938638 a affx:Transcript ; affx:unigene "iMm.24012" ; affx:translatesTo "MTFRDVAVDFSPEEWECLSLDQKSLYRDVMLENYSHLVSVGLCIYQPHGFPVPEKEQDACMDLGNEPSRFCPDTDSRWQMKKALRTNSTCATRLSHWEGMGMEPKHGLAASCPAADWEGKGQEPPQSENQEETLQQMTLACDKLPLLNLLTALQCPRLKLAEKTKEVKSEKSFSFAPEPAQLQLIHTGEKFEEDKKRGKTFPPGPKLTRYRAVQDGKKAFQCDECGKAFSFRSSLTGHKRIHTGEKPFTCKECGKAFRFHSLLSVHVRTHTGEKSYECKACGKFFNYSSDLTRHHRIHTGEKPYQCRECGKAFSCGSDLTRHERIHTGEKPYECNECGKAFIQQSHLIKHQRIHTGEKPYVCKECGKAFTCGSQLSQHRKIHTGDKLHKCKECKNSFSFALDHTQRQLIYIGEKFFEDKENGETFFPGAEFPQCETVHTGKKLYECKECGKAFSLRSIVSSLKKIHNREKLFKCKDCEKAFRCPSDLSRHQKIHTGEKPYKCKECGKGFICRSDLGRHQRVHTGVKPYVCKECGKAFTRGAHLTQHQKIHSKKSHEFNEGEKAFSSGLENTPHSLIPTGEKLWERKEYGEAVLHDPERTQLQAAKTTYDCKEKGKDFSWHSHDTDLKAVHIREKRFQCKECPKAFRYSSELTRHQRLHTGEKPYKCQECWKAFASASDLARHQRIHTGERPYECNECGKAFIQQSHLIKHQRVHSAEQPKDVMSAEKPSLGSPMLLNMREFTLVNNLINLRSVGKILLMAQLNPCQKIYTDKKLS" ; affx:hasCds [affx:startsAt "22102562" ; affx:stopsAt "22107961" ]; affx:hasExon [ affx:relatesToExon :Gene5858_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5858_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5858_e3; affx:cdsType "Partial" ; affx:cdsStart "22102562" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5858_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5858_e5; affx:cdsType "Partial" ; affx:cdsStop "22107961" ; affx:frame "1"] ; . :Gene5858_e1 a affx:Exon ; affx:startsAt "22093848" ; affx:stopsAt "22094019" ; affx:commonToAll "1" . :Gene5858_e2 a affx:Exon ; affx:startsAt "22100709" ; affx:stopsAt "22100874" ; affx:commonToAll "1" . :Gene5858_e3 a affx:Exon ; affx:startsAt "22102559" ; affx:stopsAt "22102683" ; affx:commonToAll "1" . :Gene5858_e4 a affx:Exon ; affx:startsAt "22103421" ; affx:stopsAt "22103517" ; affx:commonToAll "1" . :Gene5858_e5 a affx:Exon ; affx:startsAt "22105850" ; affx:stopsAt "22108670" ; affx:commonToAll "1" . :Gene5859 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13543163] . :gi13543163 a affx:Transcript ; affx:unigene "iMm.26514" ; affx:translatesTo "MPAPTCFSCHKTRAALRRPRSGQALCGSCFCAAFEAEVLHTVLAGHLLPPGAVVAVGASGGKDSTVLAHVLRELAPRLGITLHLVAVDEGIGGYRDAALEAVRSQAARWELPLTIVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARLVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGVLGSTGEGCALPRCRPLQFASQKEVVLYAHFRHLRYFSEECVYAPEAFRGHARDLLKLLEAARPSAVLDLVHSAERLALAPAAKPPPPGTCSRCGALASHKLCQACALLDGLNRGLPRLAIGKGRRVLQVEPPQPGNPSLVTSDPVAPAGPCTCKQPKDKANPCGNGGDRAGATCVSQCDLSPGNGEDRAGATCVSQRDLSLGNGGDRAGATCVSQCDLSPVAE" ; affx:hasCds [affx:startsAt "33276685" ; affx:stopsAt "33278942" ]; affx:hasExon [ affx:relatesToExon :Gene5859_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5859_e2; affx:cdsType "Partial" ; affx:cdsStart "33276685" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5859_e3; affx:cdsType "Partial" ; affx:cdsStop "33278942" ; affx:frame "0"] ; . :Gene5859_e1 a affx:Exon ; affx:startsAt "33273577" ; affx:stopsAt "33273622" ; affx:commonToAll "1" . :Gene5859_e2 a affx:Exon ; affx:startsAt "33276650" ; affx:stopsAt "33277193" ; affx:commonToAll "1" . :Gene5859_e3 a affx:Exon ; affx:startsAt "33278187" ; affx:stopsAt "33280059" ; affx:commonToAll "1" . :Gene5860 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13543824] . :gi13543824 a affx:Transcript ; affx:unigene "iMm.26700" ; affx:translatesTo "MEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKFIRYLKLRRQSPSDREEYVKRKQRYEVDFNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSEHKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQGKQQLLDTWMEKEKPRDVPCNNHSPTTHPEAGDGSPVPSYEYHGDAL" ; affx:hasCds [affx:startsAt "135034377" ; affx:stopsAt "135055549" ]; affx:hasExon [ affx:relatesToExon :Gene5860_e1; affx:cdsType "Partial" ; affx:cdsStart "135034377" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5860_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5860_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5860_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5860_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5860_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5860_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5860_e8; affx:cdsType "Partial" ; affx:cdsStop "135055549" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "86" ; affx:stopsAt "108" ; affx:spannedBy [ affx:startsAt "135048223" ; affx:stopsAt "135048289" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "136" ; affx:stopsAt "158" ; affx:spannedBy [ affx:startsAt "135041559" ; affx:stopsAt "135041612" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "135039993" ; affx:stopsAt "135040005" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene5860_e1 a affx:Exon ; affx:startsAt "135033004" ; affx:stopsAt "135034644" ; affx:commonToAll "1" . :Gene5860_e2 a affx:Exon ; affx:startsAt "135037079" ; affx:stopsAt "135037185" ; affx:commonToAll "1" . :Gene5860_e3 a affx:Exon ; affx:startsAt "135039820" ; affx:stopsAt "135040005" ; affx:commonToAll "1" . :Gene5860_e4 a affx:Exon ; affx:startsAt "135041559" ; affx:stopsAt "135041612" ; affx:commonToAll "1" . :Gene5860_e5 a affx:Exon ; affx:startsAt "135048138" ; affx:stopsAt "135048291" ; affx:commonToAll "1" . :Gene5860_e6 a affx:Exon ; affx:startsAt "135052615" ; affx:stopsAt "135052761" ; affx:commonToAll "1" . :Gene5860_e7 a affx:Exon ; affx:startsAt "135053547" ; affx:stopsAt "135053648" ; affx:commonToAll "1" . :Gene5860_e8 a affx:Exon ; affx:startsAt "135055540" ; affx:stopsAt "135055599" ; affx:commonToAll "1" . :Gene5861 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13879311] . :gi13879311 a affx:Transcript ; affx:unigene "iMm.27259" ; affx:translatesTo "MEKAKTHYDAKKQQNQKLQEQLQDLEELQKENKELRSEAERLGRELQQAGLKTKEAEQTCRHLTAQVRSLEAQVAHADQQLRDLGKFQVATDALKSREPQVKPQLDLSIDSLDLSLEEGTPCSVASKLPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPTPARGQAPLETSLDSLGDAFPDSGRKTRSARRRTTQIINITMTKKLELEEPDSANSSFYSTQSAPASQANLRATSSTQSLARLGSPDDGNSALLSLPGYRPTTRSSARRSQARMSSGAPQGRNSFYMGTCQDEPEQLDDWNRIAELQQRNRVCPPHLKTCYPLESRPTLSLATITDEEMKTGDPRETLRRASMQPAQIAEGVGITTRQQRKRVSSETHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSSTADTQKKAAPVLKQADRRQSMAFSILNTPKKLGNSLLRRGASKKTPAKVSPNPRSGTRRSPRIATTTTGTATVATTPRAKGKVKH" ; affx:hasCds [affx:startsAt "91835076" ; affx:stopsAt "91840030" ]; affx:hasExon [ affx:relatesToExon :Gene5861_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5861_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5861_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5861_e4; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5861_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5861_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5861_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5861_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5861_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5861_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5861_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5861_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5861_e13; affx:cdsType "Partial" ; affx:cdsStop "91840030" ; affx:frame "2"] ; . :Gene5861_e1 a affx:Exon ; affx:startsAt "91826953" ; affx:stopsAt "91827437" ; affx:commonToAll "1" . :Gene5861_e2 a affx:Exon ; affx:startsAt "91828072" ; affx:stopsAt "91828114" ; affx:commonToAll "1" . :Gene5861_e3 a affx:Exon ; affx:startsAt "91833263" ; affx:stopsAt "91833332" ; affx:commonToAll "1" . :Gene5861_e4 a affx:Exon ; affx:startsAt "91834873" ; affx:stopsAt "91834993" ; affx:commonToAll "1" . :Gene5861_e5 a affx:Exon ; affx:startsAt "91835076" ; affx:stopsAt "91835295" ; affx:commonToAll "1" . :Gene5861_e6 a affx:Exon ; affx:startsAt "91835399" ; affx:stopsAt "91835557" ; affx:commonToAll "1" . :Gene5861_e7 a affx:Exon ; affx:startsAt "91836615" ; affx:stopsAt "91836862" ; affx:commonToAll "1" . :Gene5861_e8 a affx:Exon ; affx:startsAt "91837663" ; affx:stopsAt "91837892" ; affx:commonToAll "1" . :Gene5861_e9 a affx:Exon ; affx:startsAt "91838524" ; affx:stopsAt "91838661" ; affx:commonToAll "1" . :Gene5861_e10 a affx:Exon ; affx:startsAt "91838951" ; affx:stopsAt "91839128" ; affx:commonToAll "1" . :Gene5861_e11 a affx:Exon ; affx:startsAt "91839312" ; affx:stopsAt "91839429" ; affx:commonToAll "1" . :Gene5861_e12 a affx:Exon ; affx:startsAt "91839520" ; affx:stopsAt "91839724" ; affx:commonToAll "1" . :Gene5861_e13 a affx:Exon ; affx:startsAt "91840018" ; affx:stopsAt "91840742" ; affx:commonToAll "1" . :Gene5862 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13879415] . :gi13879415 a affx:Transcript ; affx:unigene "iMm.24984" ; affx:translatesTo "MAKEEPPSVSRDLQELQRKLGLLLESFLNNSKVVAFMKSPVGRFLDRHPFVTLTVLMFVTMSAIPVGFFLLIVVLTSLGALMGAILLEGLVISVCGLSLLCVLCGLGFLSLALSGIAMMSYVVVSCLMSYWFSPSRPLTQQNANVDCQLAMKFTESERLIF" ; affx:hasCds [affx:startsAt "109753464" ; affx:stopsAt "109769023" ]; affx:hasExon [ affx:relatesToExon :Gene5862_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5862_e2; affx:cdsType "Partial" ; affx:cdsStart "109753464" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5862_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5862_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5862_e5; affx:cdsType "Partial" ; affx:cdsStop "109769023" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "53" ; affx:stopsAt "75" ; affx:spannedBy [ affx:startsAt "109764215" ; affx:stopsAt "109764281" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "80" ; affx:stopsAt "102" ; affx:spannedBy [ affx:startsAt "109764296" ; affx:stopsAt "109764321" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "109764986" ; affx:stopsAt "109765027" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "109" ; affx:stopsAt "131" ; affx:spannedBy [ affx:startsAt "109765048" ; affx:stopsAt "109765114" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene5862_e1 a affx:Exon ; affx:startsAt "109751156" ; affx:stopsAt "109751246" ; affx:commonToAll "1" . :Gene5862_e2 a affx:Exon ; affx:startsAt "109753360" ; affx:stopsAt "109753560" ; affx:commonToAll "1" . :Gene5862_e3 a affx:Exon ; affx:startsAt "109764152" ; affx:stopsAt "109764321" ; affx:commonToAll "1" . :Gene5862_e4 a affx:Exon ; affx:startsAt "109764986" ; affx:stopsAt "109765125" ; affx:commonToAll "1" . :Gene5862_e5 a affx:Exon ; affx:startsAt "109768941" ; affx:stopsAt "109769754" ; affx:commonToAll "1" . :Gene5863 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13879285] . :gi13879285 a affx:Transcript ; affx:unigene "iMm.24021" ; affx:translatesTo "MTVKKIAIFGATGRTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPQPAHVVVGDVRQAADVDKTVAGQEAVIVLLGTGNDLSPTTVMSEGTRNIVTAMKAHGVDKVVACTSAFLLWDPTKVPPRLQDVTDDHIRMHKILQESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTNEYDGHTTYPSHQYD" ; affx:hasCds [affx:startsAt "19683341" ; affx:stopsAt "19701486" ]; affx:hasExon [ affx:relatesToExon :Gene5863_e1; affx:cdsType "Partial" ; affx:cdsStart "19683341" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5863_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5863_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5863_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5863_e5; affx:cdsType "Partial" ; affx:cdsStop "19701486" ; affx:frame "0"] ; . :Gene5863_e1 a affx:Exon ; affx:startsAt "19683261" ; affx:stopsAt "19683420" ; affx:commonToAll "1" . :Gene5863_e2 a affx:Exon ; affx:startsAt "19694478" ; affx:stopsAt "19694643" ; affx:commonToAll "1" . :Gene5863_e3 a affx:Exon ; affx:startsAt "19694785" ; affx:stopsAt "19694875" ; affx:commonToAll "1" . :Gene5863_e4 a affx:Exon ; affx:startsAt "19698201" ; affx:stopsAt "19698330" ; affx:commonToAll "1" . :Gene5863_e5 a affx:Exon ; affx:startsAt "19701328" ; affx:stopsAt "19701596" ; affx:commonToAll "1" . :Gene5864 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13879509] . :gi13879509 a affx:Transcript ; affx:unigene "iMm.182195" ; affx:translatesTo "MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI" ; affx:hasCds [affx:startsAt "91724908" ; affx:stopsAt "91726198" ]; affx:hasExon [ affx:relatesToExon :Gene5864_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5864_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5864_e3; affx:cdsType "Partial" ; affx:cdsStart "91724908" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5864_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5864_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5864_e6; affx:cdsType "Partial" ; affx:cdsStop "91726198" ; affx:frame "0"] ; . :Gene5864_e1 a affx:Exon ; affx:startsAt "91708270" ; affx:stopsAt "91708348" ; affx:commonToAll "1" . :Gene5864_e2 a affx:Exon ; affx:startsAt "91724689" ; affx:stopsAt "91724774" ; affx:commonToAll "1" . :Gene5864_e3 a affx:Exon ; affx:startsAt "91724898" ; affx:stopsAt "91725028" ; affx:commonToAll "1" . :Gene5864_e4 a affx:Exon ; affx:startsAt "91725510" ; affx:stopsAt "91725570" ; affx:commonToAll "1" . :Gene5864_e5 a affx:Exon ; affx:startsAt "91725856" ; affx:stopsAt "91725994" ; affx:commonToAll "1" . :Gene5864_e6 a affx:Exon ; affx:startsAt "91726150" ; affx:stopsAt "91726502" ; affx:commonToAll "1" . :MrgA3 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi15546026] . :gi15546026 a affx:Transcript ; affx:unigene "iMm.207058" ; affx:translatesTo "LNETIPGSIDIETLIPDLMIIIFGLVGLTGNAIVFWLLGFRMHRTAFLVYILNLALADFLFLLCHIINSTVDLLKFTLPKGIFAFCFHTIKRVLYITGLSMLSAISTERCLSVLCPIWYHCRRPEHTSTVMCAVIWVLSLLICILDGYFCGYLDNHYFNYSVCQAWDIFIGAYLMFLFVVLCLSTLALLARLFCGARNMKFTRLFVTIMLTVLVFLLCGLPWGITWFLLFWIAPGVFVLDYSPLLVLTAINSCANPIIYFFVGSFRQRLNKQTLKMVLQKALQDTPETPENMVEMSRNKAEP" ; affx:hasCds [affx:startsAt "37188462" ; affx:stopsAt "37189371" ]; affx:hasExon [ affx:relatesToExon :MrgA3_e1; affx:cdsType "Partial" ; affx:cdsStart "37188462" ; affx:cdsStop "37189371" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :MrgA3_e2; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "69" ; affx:spannedBy [ affx:startsAt "37189164" ; affx:stopsAt "37189371" ; affx:inFrame "2" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "84" ; affx:stopsAt "106" ; affx:spannedBy [ affx:startsAt "37189053" ; affx:stopsAt "37189119" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "127" ; affx:stopsAt "149" ; affx:spannedBy [ affx:startsAt "37188924" ; affx:stopsAt "37188990" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "169" ; affx:stopsAt "191" ; affx:spannedBy [ affx:startsAt "37188798" ; affx:stopsAt "37188864" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "204" ; affx:stopsAt "226" ; affx:spannedBy [ affx:startsAt "37188693" ; affx:stopsAt "37188759" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "241" ; affx:stopsAt "263" ; affx:spannedBy [ affx:startsAt "37188582" ; affx:stopsAt "37188648" ; affx:inFrame "2" ] ; ] ; ] ; . :MrgA3_e1 a affx:Exon ; affx:startsAt "37188225" ; affx:stopsAt "37189441" ; affx:commonToAll "1" . :MrgA3_e2 a affx:Exon ; affx:startsAt "37200265" ; affx:stopsAt "37200344" ; affx:commonToAll "1" . :Gene5866 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13236407] . :gi13236407 a affx:Transcript ; affx:unigene "iMm.27481" ; affx:translatesTo "MAASSTVVEDITKDEQEETPEIIEQIPASESNVEEMAQAAESQANDVGFKKVFKFVGFKFTVKKDKNEKSDTVQLLTVKKDEGEGAEASVGAGDHQEPGVETVGESASKESELKQSTEKQEGTLKQAQSSTEIPLQAESGQGTEEEAAKDGEENREKEPTKPLESPTSPVSNETTSSFKKFFTHGWAGWRKKTSFKKPKEDDLETSEKRKEQEAEKVDEEEGEKTEPAPAEEQEPAEGTDQARLSADYEKVELPLEDQVGDLEALSEKCAPLATEVFDEKTEAHQEVVAEVHVSTVEKMTKGQGGAEVEGDVVVEGSGESLPPEKLAETQEVPQEAEPVEELMKTKEVCVSGGDHTQLTDLSPEEKMLPKHPEGIVSEVEMLSSQERIKVQGSPLKKLFSSSGLKKLSGKKQKGKRGGGGGDEEPGEYQHIQTESPESADEQKGESSASSPEEPEEIACLEKGPSEAPQEAEAEEGATSDGEKKREGITPWASFKKMVTPKKRVRRPSESDKEEELDKVKSATLSSTESTASGMQDEVRAVGEEQRSEEPKRRVDTSVSWEALICVGSSKKRARKASSSDDEGGPRTLGGDGHRAEEASKDKEADALPASTQEQDQAHGSSSPEPAGSPSEGEGVSTWESFKRLVTPRKKSKSKLEERAEDSGAEQLASEIEPSREESWVSIKKFIPGRRKKRADGKQEQAAVEDSGPGEINEDDPDVPAVVPLSEYDAVEREKLEAQRAQENVELPQLKGAVYVSEELSKTLVHTVSVAVIDGTRAVTSAEERSPSWISASMTEPLEHAEGVATPPVGEVTEKDITAEATPALAQTLPGGKDAHDDIVTSEVDFTSEAVTAAETTEALRAEELTEASGAEETTDMVSAVSQLSDSPDTTEEATPVQEVEGGMLDTEEQERQTQAVLQAVADKVKEDSQVPATQTLQRAGPKALEKVEEVEEDSEVLATEKEKDVVPEGPVQEAETEHLAQGSETVQATPESLEVPEVTEDVDRATTCQVIKHQQLMEQAVAPESSETLTDSETNGSTPLADSDTPNGTQQDETVDSQDSNAIAAVKQSQVTEEEAAAAQTEGPSTPSSFPAQEEHREKPGRDVLEPTQALAAGAVPILAKAEVGQEGEAGQFDGEKVKDGQCVKELEVPVHTGPNSQKTADLTRDSEVMEVARCQETESNEEQSISPEKREMGTDVEKEETETKTEQASEEHEQETAAPEHEGTHPKPVLTADMPHSERGKALGSLEGSPSLPDQDKADCIEVQVQSSDTPVTQTTEAVKKVEETVATSEMDESLECAGAQSLPAEKLSETGGYGTLQHGEDTVPQGPESQAESIPIIVTPAPESILHSDLQREVSASQKQRSDEDNKPDAGPDAAGKESAAREKILRAEPEILELESKSNKIVQSVIQTAVDQFARTETAPETHASDLQNQVPVMQADSQGAQQMLDKDESDLQVSPQDGTLSAVAQEGLAVSDSSEGMSKASEMITTLAVESASVKESVEKLPLQCKDEKEHAADGPQHQSLAKAEADASGNLTKESPDTNGPKLTEEGDALKEEMNKAQTEEDDLQEPKGDLTES" ; affx:hasCds [affx:startsAt "120833654" ; affx:stopsAt "120838394" ]; affx:hasExon [ affx:relatesToExon :Gene5866_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5866_e2; affx:cdsType "Partial" ; affx:cdsStart "120833654" ; affx:cdsStop "120838394" ; affx:frame "2"] ; . :Gene5866_e1 a affx:Exon ; affx:startsAt "120832114" ; affx:stopsAt "120833108" ; affx:commonToAll "1" . :Gene5866_e2 a affx:Exon ; affx:startsAt "120833646" ; affx:stopsAt "120838444" ; affx:commonToAll "1" . :Gene5867 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13936733] . :gi13936733 a affx:Transcript ; affx:unigene "iMm.157702" ; affx:translatesTo "MLLLLLLLLWGIKGVEGQNPQEVFTLNVERKVVVQEGLCVLVPCNFSYLKKRLTDWTDSDPVHGFWYREGTDRRKDSIVATNNPIRKAVKETRNRFFLLGDPWRNDCSLNIREIRKKDAGLYFFRLERGKTKYNYMWDKMTLVVTALTNTPQILLPETLEAGHPSNLTCSVPWDCGWTAPPIFSWTGTSVSFLSTNTTGSSVLTITPQPQDHGTNLTCQVTLPGTNVSTRMTIRLNVSYAPKNLTVTIYQGADSVSTILKNGSSLPISEGQSLRLICSTDSYPPANLSWSWDNLTLCPSKLSKPGLLELFPVHLKHGGVYTCQAQHALGSQHISLSLSPQSSATLSEMMMGTFVGSGVTALLFLSVCILLLAVRSYRRKPARPAVVAPHPDALKVSVSQNPLVESQADDSSEPLPSILEAAPSSTEEEIHYATLSFHEMKPMNLWGQQDTTTEYSEIKFPQRTAWP" ; affx:hasCds [affx:startsAt "33252930" ; affx:stopsAt "33261678" ]; affx:hasExon [ affx:relatesToExon :Gene5867_e1; affx:cdsType "Partial" ; affx:cdsStart "33252930" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5867_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5867_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5867_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5867_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5867_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5867_e7; affx:cdsType "Partial" ; affx:cdsStop "33261665" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "17" ; affx:spannedBy [ affx:startsAt "33261668" ; affx:stopsAt "33261678" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "33261624" ; affx:stopsAt "33261665" ; affx:inFrame "2" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "351" ; affx:stopsAt "373" ; affx:spannedBy [ affx:startsAt "33257970" ; affx:stopsAt "33258032" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "33257614" ; affx:stopsAt "33257618" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene5867_e1 a affx:Exon ; affx:startsAt "33252537" ; affx:stopsAt "33253134" ; affx:commonToAll "1" . :Gene5867_e2 a affx:Exon ; affx:startsAt "33257536" ; affx:stopsAt "33257618" ; affx:commonToAll "1" . :Gene5867_e3 a affx:Exon ; affx:startsAt "33257970" ; affx:stopsAt "33258064" ; affx:commonToAll "1" . :Gene5867_e4 a affx:Exon ; affx:startsAt "33258982" ; affx:stopsAt "33259240" ; affx:commonToAll "1" . :Gene5867_e5 a affx:Exon ; affx:startsAt "33260417" ; affx:stopsAt "33260465" ; affx:commonToAll "1" . :Gene5867_e6 a affx:Exon ; affx:startsAt "33260755" ; affx:stopsAt "33261034" ; affx:commonToAll "1" . :Gene5867_e7 a affx:Exon ; affx:startsAt "33261239" ; affx:stopsAt "33261707" ; affx:commonToAll "1" . :Gene5868 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi14582711] . :gi14582711 a affx:Transcript ; affx:unigene "iMm.19291" ; affx:translatesTo "MRHCINCCVQLFPEDTHKQQVACQGGPHHSHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGGFLRFRKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSVMDGENPSDVKEHHYQPSVNNISYVKDYPSIKLIIDSIAARIEFTTRQLPDLQDLKRQELHMFSVIPSKFLPTSKSPCWYEEFSGRNTTDPYLTNSYVLYSKRFRSTFDALRKVFWGHLSHVQGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQAASAEQPSKMNKIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPEAKLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFQNCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLTVFSKEQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNTRRPEDRSLGPMWPITQKILREFYGPFNTRLAQVLDDEAFAWKTT" ; affx:hasCds [affx:startsAt "122215512" ; affx:stopsAt "122248985" ]; affx:hasExon [ affx:relatesToExon :Gene5868_e1; affx:cdsType "Partial" ; affx:cdsStart "122215512" ; affx:cdsStop "122215514" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5868_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5868_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5868_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5868_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5868_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5868_e7; affx:cdsType "Partial" ; affx:cdsStop "122248985" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "80" ; affx:stopsAt "102" ; affx:spannedBy [ affx:startsAt "122248679" ; affx:stopsAt "122248745" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene5868_e1 a affx:Exon ; affx:startsAt "122215506" ; affx:stopsAt "122215704" ; affx:commonToAll "1" . :Gene5868_e2 a affx:Exon ; affx:startsAt "122219652" ; affx:stopsAt "122219800" ; affx:commonToAll "1" . :Gene5868_e3 a affx:Exon ; affx:startsAt "122226199" ; affx:stopsAt "122226356" ; affx:commonToAll "1" . :Gene5868_e4 a affx:Exon ; affx:startsAt "122241019" ; affx:stopsAt "122241176" ; affx:commonToAll "1" . :Gene5868_e5 a affx:Exon ; affx:startsAt "122244993" ; affx:stopsAt "122245140" ; affx:commonToAll "1" . :Gene5868_e6 a affx:Exon ; affx:startsAt "122247353" ; affx:stopsAt "122247693" ; affx:commonToAll "1" . :Gene5868_e7 a affx:Exon ; affx:startsAt "122248439" ; affx:stopsAt "122249034" ; affx:commonToAll "1" . :Gene5869 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi15963499] . :gi15963499 a affx:Transcript ; affx:unigene "iMm.35226" ; affx:translatesTo "MRWAWLLPLLWAGCLATDGYSLSVTGSVTVQEGLCVFVACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCSLDIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLVIALTEVPNIQVTSTLVSGNSTKLLCSVPWACEQGTPPIFSWMSSALTSLGHRTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLSVIYAPQKMTIRVSWGDDTGTKVLQSGASLQIQEGESLSLVCMADSNPPAVLSWERPTQKPFQLSTPAELQLPRAELEDQGKYICQAQNSQGAQTASVSLSIRSLLQLLGPSCSFEGQGLHCSCSSRAWPAPSLRWRLGEGVLEGNSSNGSFTVKSSSAGQWANSSLILSMEFSSNHRLSCEAWSDNRVQRATILLVSGPKVSQAGKSETSRGTVLGAIWGAGLMALLAVCLCLIFFTVKVLRKKSALKVAATKGNHLAKNPASTINSASITSSNIALGYPIQGHLNEPGSQTQKEQPPLATVPDTQKDEPELHYASLSFQGPMPPKPQNTEAMKSVYTEIKIHKC" ; affx:hasCds [affx:startsAt "32952437" ; affx:stopsAt "32959423" ]; affx:hasExon [ affx:relatesToExon :Gene5869_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5869_e2; affx:cdsType "Partial" ; affx:cdsStart "32952437" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5869_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5869_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5869_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5869_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5869_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5869_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5869_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5869_e10; affx:cdsType "Partial" ; affx:cdsStop "32959423" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "16" ; affx:spannedBy [ affx:startsAt "32952437" ; affx:stopsAt "32952474" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "32952536" ; affx:stopsAt "32952547" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "440" ; affx:stopsAt "462" ; affx:spannedBy [ affx:startsAt "32956586" ; affx:stopsAt "32956648" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "32956949" ; affx:stopsAt "32956953" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene5869_e1 a affx:Exon ; affx:startsAt "32952294" ; affx:stopsAt "32952310" ; affx:commonToAll "1" . :Gene5869_e2 a affx:Exon ; affx:startsAt "32952413" ; affx:stopsAt "32952474" ; affx:commonToAll "1" . :Gene5869_e3 a affx:Exon ; affx:startsAt "32952536" ; affx:stopsAt "32952899" ; affx:commonToAll "1" . :Gene5869_e4 a affx:Exon ; affx:startsAt "32953057" ; affx:stopsAt "32953336" ; affx:commonToAll "1" . :Gene5869_e5 a affx:Exon ; affx:startsAt "32953511" ; affx:stopsAt "32953559" ; affx:commonToAll "1" . :Gene5869_e6 a affx:Exon ; affx:startsAt "32955624" ; affx:stopsAt "32955876" ; affx:commonToAll "1" . :Gene5869_e7 a affx:Exon ; affx:startsAt "32955975" ; affx:stopsAt "32956278" ; affx:commonToAll "1" . :Gene5869_e8 a affx:Exon ; affx:startsAt "32956548" ; affx:stopsAt "32956648" ; affx:commonToAll "1" . :Gene5869_e9 a affx:Exon ; affx:startsAt "32956949" ; affx:stopsAt "32957085" ; affx:commonToAll "1" . :Gene5869_e10 a affx:Exon ; affx:startsAt "32959231" ; affx:stopsAt "32960119" ; affx:commonToAll "1" . :Gene5870 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi12744897] . :gi12744897 a affx:Transcript ; affx:unigene "iMm.4361" ; affx:translatesTo "MGFLKFSPFLVVSILLLYQACSLQAVPLRSILESSPGMATLSEEEVRLLAALVQDYMQMKARELEQEEEQEAEGSSVTAQKRSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAFGRRRRDLQA" ; affx:hasCds [affx:startsAt "104258741" ; affx:stopsAt "104261514" ]; affx:hasExon [ affx:relatesToExon :Gene5870_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5870_e2; affx:cdsType "Partial" ; affx:cdsStart "104258741" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5870_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5870_e4; affx:cdsType "Partial" ; affx:cdsStop "104261514" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5870_e5; affx:cdsType "None" ] ; . :Gene5870_e1 a affx:Exon ; affx:startsAt "104257965" ; affx:stopsAt "104258207" ; affx:commonToAll "1" . :Gene5870_e2 a affx:Exon ; affx:startsAt "104258717" ; affx:stopsAt "104258901" ; affx:commonToAll "1" . :Gene5870_e3 a affx:Exon ; affx:startsAt "104260769" ; affx:stopsAt "104260910" ; affx:commonToAll "1" . :Gene5870_e4 a affx:Exon ; affx:startsAt "104261428" ; affx:stopsAt "104261523" ; affx:commonToAll "1" . :Gene5870_e5 a affx:Exon ; affx:startsAt "104262513" ; affx:stopsAt "104262597" ; affx:commonToAll "1" . :Gene5871 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18606264] . :gi18606264 a affx:Transcript ; affx:unigene "iMm.41637" ; affx:translatesTo "MTDGILGKAATMEIPIHGNGEAGQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTSPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQTHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ" ; affx:hasCds [affx:startsAt "95405661" ; affx:stopsAt "95408847" ]; affx:hasExon [ affx:relatesToExon :Gene5871_e1; affx:cdsType "Partial" ; affx:cdsStart "95405661" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5871_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5871_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5871_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5871_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5871_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5871_e7; affx:cdsType "Partial" ; affx:cdsStop "95408847" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5871_e8; affx:cdsType "None" ] ; . :Gene5871_e1 a affx:Exon ; affx:startsAt "95405044" ; affx:stopsAt "95405817" ; affx:commonToAll "1" . :Gene5871_e2 a affx:Exon ; affx:startsAt "95406234" ; affx:stopsAt "95406409" ; affx:commonToAll "1" . :Gene5871_e3 a affx:Exon ; affx:startsAt "95406544" ; affx:stopsAt "95406702" ; affx:commonToAll "1" . :Gene5871_e4 a affx:Exon ; affx:startsAt "95407242" ; affx:stopsAt "95407464" ; affx:commonToAll "1" . :Gene5871_e5 a affx:Exon ; affx:startsAt "95407632" ; affx:stopsAt "95407751" ; affx:commonToAll "1" . :Gene5871_e6 a affx:Exon ; affx:startsAt "95408432" ; affx:stopsAt "95408529" ; affx:commonToAll "1" . :Gene5871_e7 a affx:Exon ; affx:startsAt "95408748" ; affx:stopsAt "95408889" ; affx:commonToAll "1" . :Gene5871_e8 a affx:Exon ; affx:startsAt "95409668" ; affx:stopsAt "95409764" ; affx:commonToAll "1" . :Gene5872 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi16359221] . :gi16359221 a affx:Transcript ; affx:unigene "iMm.153684" ; affx:translatesTo "MLSKGLKRKREEEETMEALSVDSCWLDPSHPAVAQTPPTVASSSLFDLSVVKLHHSLRQSEPDLRHLVLVVNTLRRIQASMEPAPVLPPEPIQPPAPSVADSLLASSDAGLSASMASLLEDLNHIEDLNQAPQPQADEGPPGRSIGGISPNLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDSELWLPASEGLKPGPENGPAKEEPPELDEAELDYLMDVLVGTQALERPPGPGR" ; affx:hasCds [affx:startsAt "19724925" ; affx:stopsAt "19725636" ]; affx:hasExon [ affx:relatesToExon :Gene5872_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5872_e2; affx:cdsType "Partial" ; affx:cdsStart "19724925" ; affx:cdsStop "19725636" ; affx:frame "0"] ; . :Gene5872_e1 a affx:Exon ; affx:startsAt "19722662" ; affx:stopsAt "19722748" ; affx:commonToAll "1" . :Gene5872_e2 a affx:Exon ; affx:startsAt "19724922" ; affx:stopsAt "19725982" ; affx:commonToAll "1" . :Gene5873 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi16975522] . :gi16975522 a affx:Transcript ; affx:unigene "iMm.200969" ; affx:translatesTo "MRRLQARMAQIRSGRGLDGAVDMGARGAAARDLAQSFVDEAQSQGGQVFQAGDVPSSSPFFSPALVSGLPPAAPCAQAEVPWPVVMASPFRTVKEALALANGTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPAVPTGGCKESGSSWHGGPDGLYEYLQPLGTPSQESFLCENINYDTFGLAASSILPSGPETGPSPAPPYGLFVGGRFQSPGTQSSRPIQDSSGKVSSYVAEGGAKDIRGAVEAAHQAAPGWGAQSPRARAGLLWALAAALERRKPVLTSQLERHGAAPTVAKIEVELSVRRLQTWGTRVQDQGQTLQVTGLRGPVLRLREPLGVLAVVCPDEWPLLAFVSLLAPALAHGNAVVLVPSGACPLLALEVCQDIAPLFPAGLVSVVTGDRDHLTRCLALHQDVQALWYFGSAQGSQFVEWASAGNLKSVWVNRGFPRAWDVEVQGAGQELSLHAARTKALWLPMGD" ; affx:hasCds [affx:startsAt "34708751" ; affx:stopsAt "34713704" ]; affx:hasExon [ affx:relatesToExon :Gene5873_e1; affx:cdsType "Partial" ; affx:cdsStart "34708751" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e10; affx:cdsType "Partial" ; affx:cdsStop "34713704" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5873_e11; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5873_e12; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5873_e13; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5873_e14; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5873_e15; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5873_e16; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5873_e17; affx:cdsType "None" ] ; . :Gene5873_e1 a affx:Exon ; affx:startsAt "34708650" ; affx:stopsAt "34708913" ; affx:commonToAll "1" . :Gene5873_e2 a affx:Exon ; affx:startsAt "34709590" ; affx:stopsAt "34709713" ; affx:commonToAll "1" . :Gene5873_e3 a affx:Exon ; affx:startsAt "34709923" ; affx:stopsAt "34710109" ; affx:commonToAll "1" . :Gene5873_e4 a affx:Exon ; affx:startsAt "34711323" ; affx:stopsAt "34711525" ; affx:commonToAll "1" . :Gene5873_e5 a affx:Exon ; affx:startsAt "34711677" ; affx:stopsAt "34711845" ; affx:commonToAll "1" . :Gene5873_e6 a affx:Exon ; affx:startsAt "34712286" ; affx:stopsAt "34712417" ; affx:commonToAll "1" . :Gene5873_e7 a affx:Exon ; affx:startsAt "34712495" ; affx:stopsAt "34712601" ; affx:commonToAll "1" . :Gene5873_e8 a affx:Exon ; affx:startsAt "34712713" ; affx:stopsAt "34712850" ; affx:commonToAll "1" . :Gene5873_e9 a affx:Exon ; affx:startsAt "34713134" ; affx:stopsAt "34713230" ; affx:commonToAll "1" . :Gene5873_e10 a affx:Exon ; affx:startsAt "34713563" ; affx:stopsAt "34713749" ; affx:commonToAll "1" . :Gene5873_e11 a affx:Exon ; affx:startsAt "34714102" ; affx:stopsAt "34714255" ; affx:commonToAll "1" . :Gene5873_e12 a affx:Exon ; affx:startsAt "34714339" ; affx:stopsAt "34714521" ; affx:commonToAll "1" . :Gene5873_e13 a affx:Exon ; affx:startsAt "34714665" ; affx:stopsAt "34714743" ; affx:commonToAll "1" . :Gene5873_e14 a affx:Exon ; affx:startsAt "34714824" ; affx:stopsAt "34715003" ; affx:commonToAll "1" . :Gene5873_e15 a affx:Exon ; affx:startsAt "34715554" ; affx:stopsAt "34715681" ; affx:commonToAll "1" . :Gene5873_e16 a affx:Exon ; affx:startsAt "34716604" ; affx:stopsAt "34716707" ; affx:commonToAll "1" . :Gene5873_e17 a affx:Exon ; affx:startsAt "34721332" ; affx:stopsAt "34721479" ; affx:commonToAll "1" . :Gene5874 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi15928813] . :gi15928813 a affx:Transcript ; affx:unigene "iMm.177502" ; affx:translatesTo "MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFTPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRGHGETKVKNSEDLSAETMAKDVGNVVEAMYGDLPPPVMLIGHSMGGAIAVHTAAANLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSIVEGIIEEEEEDEEGSESVNKRKKEDDMETKKDHPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC" ; affx:hasCds [affx:startsAt "90142239" ; affx:stopsAt "90186061" ]; affx:hasExon [ affx:relatesToExon :Gene5874_e1; affx:cdsType "Partial" ; affx:cdsStart "90142239" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5874_e14; affx:cdsType "Partial" ; affx:cdsStop "90186061" ; affx:frame "1"] ; . :Gene5874_e1 a affx:Exon ; affx:startsAt "90141112" ; affx:stopsAt "90142258" ; affx:commonToAll "1" . :Gene5874_e2 a affx:Exon ; affx:startsAt "90143410" ; affx:stopsAt "90143478" ; affx:commonToAll "1" . :Gene5874_e3 a affx:Exon ; affx:startsAt "90146232" ; affx:stopsAt "90146297" ; affx:commonToAll "1" . :Gene5874_e4 a affx:Exon ; affx:startsAt "90148322" ; affx:stopsAt "90148367" ; affx:commonToAll "1" . :Gene5874_e5 a affx:Exon ; affx:startsAt "90149442" ; affx:stopsAt "90149572" ; affx:commonToAll "1" . :Gene5874_e6 a affx:Exon ; affx:startsAt "90152723" ; affx:stopsAt "90152847" ; affx:commonToAll "1" . :Gene5874_e7 a affx:Exon ; affx:startsAt "90155384" ; affx:stopsAt "90155450" ; affx:commonToAll "1" . :Gene5874_e8 a affx:Exon ; affx:startsAt "90156199" ; affx:stopsAt "90156290" ; affx:commonToAll "1" . :Gene5874_e9 a affx:Exon ; affx:startsAt "90159627" ; affx:stopsAt "90159782" ; affx:commonToAll "1" . :Gene5874_e10 a affx:Exon ; affx:startsAt "90162480" ; affx:stopsAt "90162532" ; affx:commonToAll "1" . :Gene5874_e11 a affx:Exon ; affx:startsAt "90162797" ; affx:stopsAt "90162855" ; affx:commonToAll "1" . :Gene5874_e12 a affx:Exon ; affx:startsAt "90168831" ; affx:stopsAt "90168924" ; affx:commonToAll "1" . :Gene5874_e13 a affx:Exon ; affx:startsAt "90169390" ; affx:stopsAt "90169484" ; affx:commonToAll "1" . :Gene5874_e14 a affx:Exon ; affx:startsAt "90185960" ; affx:stopsAt "90186134" ; affx:commonToAll "1" . :Gene5875 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi16741322] . :gi16741322 a affx:Transcript ; affx:unigene "iMm.23565" ; affx:translatesTo "MALYDEDLLKNPFYLALQKWRPDLCSKVAQIHGIVLVPCRGSLPGSVQASCQFESYVLVPTEGHFQTLDGKAVVIEGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCIAHPLERRETSEEPSAPADPFSLKTIEDVREFLGRHSEKFDKNIASFHRTFRECERKSLRHHIDSVNALYTKCLQQLLRDSHLKVLAKQEAQMNLMKQAVEMYVHHDIYDLIFKYVGTMEASEDAAFNKITRSLQDLQQKDIGVKPEFSFNIPRAKRELGQLNKCTSPQQKLLCLRKVVQLMTQSPSQRVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSSSAKDELGYCLTSVEAAIEYIRQGSLSTKTPVRSPC" ; affx:hasCds [affx:startsAt "26092537" ; affx:stopsAt "26109228" ]; affx:hasExon [ affx:relatesToExon :Gene5875_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5875_e2; affx:cdsType "Partial" ; affx:cdsStart "26092537" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5875_e12; affx:cdsType "Partial" ; affx:cdsStop "26109228" ; affx:frame "2"] ; . :Gene5875_e1 a affx:Exon ; affx:startsAt "26087020" ; affx:stopsAt "26087137" ; affx:commonToAll "1" . :Gene5875_e2 a affx:Exon ; affx:startsAt "26092508" ; affx:stopsAt "26092639" ; affx:commonToAll "1" . :Gene5875_e3 a affx:Exon ; affx:startsAt "26101071" ; affx:stopsAt "26101182" ; affx:commonToAll "1" . :Gene5875_e4 a affx:Exon ; affx:startsAt "26102246" ; affx:stopsAt "26102403" ; affx:commonToAll "1" . :Gene5875_e5 a affx:Exon ; affx:startsAt "26103184" ; affx:stopsAt "26103339" ; affx:commonToAll "1" . :Gene5875_e6 a affx:Exon ; affx:startsAt "26104311" ; affx:stopsAt "26104371" ; affx:commonToAll "1" . :Gene5875_e7 a affx:Exon ; affx:startsAt "26104455" ; affx:stopsAt "26104509" ; affx:commonToAll "1" . :Gene5875_e8 a affx:Exon ; affx:startsAt "26104592" ; affx:stopsAt "26104658" ; affx:commonToAll "1" . :Gene5875_e9 a affx:Exon ; affx:startsAt "26104969" ; affx:stopsAt "26105046" ; affx:commonToAll "1" . :Gene5875_e10 a affx:Exon ; affx:startsAt "26106539" ; affx:stopsAt "26106661" ; affx:commonToAll "1" . :Gene5875_e11 a affx:Exon ; affx:startsAt "26107857" ; affx:stopsAt "26107936" ; affx:commonToAll "1" . :Gene5875_e12 a affx:Exon ; affx:startsAt "26109077" ; affx:stopsAt "26109859" ; affx:commonToAll "1" . :Gene5876 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi16359351] . :gi16359351 a affx:Transcript ; affx:unigene "iMm.8025" ; affx:translatesTo "MKLTGALLLLGAALLLISEGDCGLCPALQRKVDLFLNGTTEEYVEYLKQFNENTKVLENAANIKKCSDRTLTEEDKAQATSLINKITASRTC" ; affx:hasCds [affx:startsAt "24507357" ; affx:stopsAt "24508542" ]; affx:hasExon [ affx:relatesToExon :Gene5876_e1; affx:cdsType "Partial" ; affx:cdsStart "24507357" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5876_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5876_e3; affx:cdsType "Partial" ; affx:cdsStop "24508542" ; affx:frame "2"] ; . :Gene5876_e1 a affx:Exon ; affx:startsAt "24507356" ; affx:stopsAt "24507418" ; affx:commonToAll "1" . :Gene5876_e2 a affx:Exon ; affx:startsAt "24507539" ; affx:stopsAt "24507727" ; affx:commonToAll "1" . :Gene5876_e3 a affx:Exon ; affx:startsAt "24508512" ; affx:stopsAt "24508671" ; affx:commonToAll "1" . :Gene5877 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi15489094] . :gi15489094 a affx:Transcript ; affx:unigene "iMm.104394" ; affx:translatesTo "MWFLILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQPWHVAVYRYNKYICGGVLLDRNWVLTAAHCHVSQYNVWLGKTKLFQREPSAQHRMVSKSFPHPDYNMSLLIIHNPEPEDDESNDLMLLRLSEPADITDAVKPIALPTEEPKLGSTCLVSGWGSITPTKFQTPDDLQCVSIKLLPNEVCVKNHNQKVTDVMLCAGEMGGGKDTCKGDSGGPLICDGVLHGITAWGPIPCGKPNTPGVYTKLIKFTNWIKDTMAKNP" ; affx:hasCds [affx:startsAt "33597797" ; affx:stopsAt "33601724" ]; affx:hasExon [ affx:relatesToExon :Gene5877_e1; affx:cdsType "Partial" ; affx:cdsStart "33597797" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5877_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5877_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5877_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5877_e5; affx:cdsType "Partial" ; affx:cdsStop "33601724" ; affx:frame "1"] ; . :Gene5877_e1 a affx:Exon ; affx:startsAt "33597771" ; affx:stopsAt "33597843" ; affx:commonToAll "1" . :Gene5877_e2 a affx:Exon ; affx:startsAt "33599584" ; affx:stopsAt "33599744" ; affx:commonToAll "1" . :Gene5877_e3 a affx:Exon ; affx:startsAt "33600674" ; affx:stopsAt "33600961" ; affx:commonToAll "1" . :Gene5877_e4 a affx:Exon ; affx:startsAt "33601057" ; affx:stopsAt "33601194" ; affx:commonToAll "1" . :Gene5877_e5 a affx:Exon ; affx:startsAt "33601568" ; affx:stopsAt "33601773" ; affx:commonToAll "1" . :Zin a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi15778439] . :gi15778439 a affx:Transcript ; affx:unigene "iMm.21612" ; affx:translatesTo "MMEERAAAAVASAASSCRPLGSGTAPNPTAAAPASSPAPGPGPVGKGGGGGGSPGPTAGPEPLSLPGILHFIQHEWARFEAEKARWEAERAELQAQVAFLQGERKGQENLKTDLVRRIKMLEYALKQERAKYHKLKFGTDLNQGEKKTDLSEQVSNGPVESVTLENSPLVWKEGRQLLRQYLEEVGYTDTILDMRSKRVRSLLGRSLELNGAGEPVEGAPRASPGPGGLSGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLEQIPFLQNCEDEDSDEDDELDSVQHKKQRVRLPSKALVPEMEDEDEEDDSEDAINEFDFLGSGEDGEGSPDPRRCTSEGNPHELESRRVKLQGILADLRDVDGLPPKVTVPPPGTPQPRPHEGSFGFSSDVFIMDTIGGGEVSLGDLADLTVTNDNDLSCDLSDSKDAFKKTWNPKFTLRSHYDGIRSLAFHHSQSALLTASEDGTLKLWNLQKAVTAKKNAALDVEPIHAFRAHRGPVLAVTMGSNSEYCYSGGADARIHSWKIPDLNMDPYDGYDPSVLSHVLEGHGDAVWGLAFSPTSQRLASCSADGTVRIWDPSSSGPSCLCTFPMDGEHGIPTSVAFTSTEPAHVVASFRSGDTVLYDLEAGSALLTLESRGSSGPAQINQVVSHPSQPLTITAHDDRGIRFLDNRTGKSVHSMVAHLDAVTCLAVDPNGVFLMSGSHDCSLRLWSLDNKTCVQEITAHRKKHEEAIHAVACHPSKALIASAGADALAKVFV" ; affx:hasCds [affx:startsAt "11955957" ; affx:stopsAt "11979578" ]; affx:hasExon [ affx:relatesToExon :Zin_e1; affx:cdsType "Partial" ; affx:cdsStart "11955957" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zin_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Zin_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zin_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Zin_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Zin_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zin_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zin_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zin_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Zin_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zin_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Zin_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zin_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Zin_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zin_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Zin_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Zin_e17; affx:cdsType "Partial" ; affx:cdsStop "11979578" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Zin_e18; affx:cdsType "None" ] ; . :Zin_e1 a affx:Exon ; affx:startsAt "11955492" ; affx:stopsAt "11956239" ; affx:commonToAll "1" . :Zin_e2 a affx:Exon ; affx:startsAt "11962100" ; affx:stopsAt "11962204" ; affx:commonToAll "1" . :Zin_e3 a affx:Exon ; affx:startsAt "11962610" ; affx:stopsAt "11962684" ; affx:commonToAll "1" . :Zin_e4 a affx:Exon ; affx:startsAt "11963742" ; affx:stopsAt "11963821" ; affx:commonToAll "1" . :Zin_e5 a affx:Exon ; affx:startsAt "11966067" ; affx:stopsAt "11966265" ; affx:commonToAll "1" . :Zin_e6 a affx:Exon ; affx:startsAt "11968340" ; affx:stopsAt "11968482" ; affx:commonToAll "1" . :Zin_e7 a affx:Exon ; affx:startsAt "11969991" ; affx:stopsAt "11970151" ; affx:commonToAll "1" . :Zin_e8 a affx:Exon ; affx:startsAt "11970690" ; affx:stopsAt "11970804" ; affx:commonToAll "1" . :Zin_e9 a affx:Exon ; affx:startsAt "11971130" ; affx:stopsAt "11971246" ; affx:commonToAll "1" . :Zin_e10 a affx:Exon ; affx:startsAt "11972591" ; affx:stopsAt "11972767" ; affx:commonToAll "1" . :Zin_e11 a affx:Exon ; affx:startsAt "11972843" ; affx:stopsAt "11972891" ; affx:commonToAll "1" . :Zin_e12 a affx:Exon ; affx:startsAt "11973540" ; affx:stopsAt "11973662" ; affx:commonToAll "1" . :Zin_e13 a affx:Exon ; affx:startsAt "11977229" ; affx:stopsAt "11977400" ; affx:commonToAll "1" . :Zin_e14 a affx:Exon ; affx:startsAt "11977516" ; affx:stopsAt "11977657" ; affx:commonToAll "1" . :Zin_e15 a affx:Exon ; affx:startsAt "11977937" ; affx:stopsAt "11978036" ; affx:commonToAll "1" . :Zin_e16 a affx:Exon ; affx:startsAt "11978230" ; affx:stopsAt "11978317" ; affx:commonToAll "1" . :Zin_e17 a affx:Exon ; affx:startsAt "11979408" ; affx:stopsAt "11979640" ; affx:commonToAll "1" . :Zin_e18 a affx:Exon ; affx:startsAt "11979873" ; affx:stopsAt "11980571" ; affx:commonToAll "1" . :Oscar a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18376822] ; affx:hasVariant [affx:representedBy :gi18376824] . :gi18376822 a affx:Transcript ; affx:unigene "iMm.215149" ; affx:translatesTo "MVLSLILQLSTLWPACRADFTPTAPLASYPQPWLGAHPAAVVTPGINVTLTCRAPQSAWRFALFKSGLVTPLLLRDVSVELAEFFLEEVTPAQGGSYHCRYRKTDWGPGVWSQPSNVLELLVTDQLPRPSLVALPGPVVAPGANVSLRCAGRIPGMSFALYRVGVATPLQYIDSVQPWADFLLIGTHTPGTYCCYYHTPSAPYVLSQRSQPLVISFEGSGSLDYTQGNLIRLGLAGMVLICLGIIVTCDWHSRSSAFDGLLPQQN" ; affx:hasCds [affx:startsAt "3044285" ; affx:stopsAt "3051251" ]; affx:hasExon [ affx:relatesToExon :Oscar_e2; affx:cdsType "Partial" ; affx:cdsStart "3044285" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Oscar_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Oscar_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Oscar_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Oscar_e7; affx:cdsType "Partial" ; affx:cdsStop "3051251" ; affx:frame "0"] ; . :gi18376824 a affx:Transcript ; affx:unigene "iMm.215149" ; affx:translatesTo "MVLSLILQLSTLCELSLPWPACRADFTPTAPLASYPQPWLGAHPAAVVTPGINVTLTCRAPQSAWRFALFKSGLVTPLLLRDVSVELAEFFLEEVTPAQGGSYHCRYRKTDWGPGVWSQPSNVLELLVTDQLPRPSLVALPGPVVAPGANVSLRCAGRIPGMSFALYRVGVATPLQYIDSVQPWADFLLIGTHTPGTYCCYYHTPSAPYVLSQRSQPLVISFEGSGSLDYTQGNLIRLGLAGMVLICLGIIVTCDWHSRSSAFDGLLPQQN" ; affx:hasCds [affx:startsAt "3044285" ; affx:stopsAt "3051251" ]; affx:hasExon [ affx:relatesToExon :Oscar_e1; affx:cdsType "Partial" ; affx:cdsStart "3044285" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Oscar_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Oscar_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Oscar_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Oscar_e6; affx:cdsType "Partial" ; affx:cdsStop "3051251" ; affx:frame "0"] ; . :Oscar_e1 a affx:Exon ; affx:startsAt "3043334" ; affx:stopsAt "3044431" ; affx:commonToAll "0" . :Oscar_e2 a affx:Exon ; affx:startsAt "3044133" ; affx:stopsAt "3044431" ; affx:commonToAll "0" . :Oscar_e3 a affx:Exon ; affx:startsAt "3044590" ; affx:stopsAt "3044872" ; affx:commonToAll "1" . :Oscar_e4 a affx:Exon ; affx:startsAt "3045105" ; affx:stopsAt "3045405" ; affx:commonToAll "1" . :Oscar_e5 a affx:Exon ; affx:startsAt "3050519" ; affx:stopsAt "3050552" ; affx:commonToAll "1" . :Oscar_e6 a affx:Exon ; affx:startsAt "3051196" ; affx:stopsAt "3051307" ; affx:commonToAll "0" . :Oscar_e7 a affx:Exon ; affx:startsAt "3051214" ; affx:stopsAt "3051331" ; affx:commonToAll "0" . :Gene5880 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi14091316] . :gi14091316 a affx:Transcript ; affx:unigene "iMm.141563" ; affx:translatesTo "MAGAGGGGCPAGGNDFQWCFSQVKGAVDEDVAEADIISTVEFNYSGDLLATGDKGGRVVIFQREQENKGRAHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLSTNDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFANAHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPHQCNVFVYSSSKGTIRLCDMRSSALCDRHAKFFEEPEDPSSRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKVWDLNMEGRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSAIMTGSYNNFFRMFDRNTRRDVTLEASRENSKPRASLKPRKVCTGGKRKKDEISVDSLDFNKKILHTAWHPMESIIAVAATNNLYIFQDKIN" ; affx:hasCds [affx:startsAt "128940844" ; affx:stopsAt "128976922" ]; affx:hasExon [ affx:relatesToExon :Gene5880_e1; affx:cdsType "Partial" ; affx:cdsStart "128940844" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5880_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5880_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5880_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5880_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5880_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5880_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5880_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5880_e9; affx:cdsType "Partial" ; affx:cdsStop "128976922" ; affx:frame "0"] ; . :Gene5880_e1 a affx:Exon ; affx:startsAt "128940813" ; affx:stopsAt "128940851" ; affx:commonToAll "1" . :Gene5880_e2 a affx:Exon ; affx:startsAt "128940947" ; affx:stopsAt "128941040" ; affx:commonToAll "1" . :Gene5880_e3 a affx:Exon ; affx:startsAt "128962745" ; affx:stopsAt "128962843" ; affx:commonToAll "1" . :Gene5880_e4 a affx:Exon ; affx:startsAt "128964025" ; affx:stopsAt "128964191" ; affx:commonToAll "1" . :Gene5880_e5 a affx:Exon ; affx:startsAt "128964725" ; affx:stopsAt "128964838" ; affx:commonToAll "1" . :Gene5880_e6 a affx:Exon ; affx:startsAt "128967307" ; affx:stopsAt "128967485" ; affx:commonToAll "1" . :Gene5880_e7 a affx:Exon ; affx:startsAt "128968553" ; affx:stopsAt "128968718" ; affx:commonToAll "1" . :Gene5880_e8 a affx:Exon ; affx:startsAt "128970889" ; affx:stopsAt "128971151" ; affx:commonToAll "1" . :Gene5880_e9 a affx:Exon ; affx:startsAt "128976642" ; affx:stopsAt "128977480" ; affx:commonToAll "1" . :Gene5881 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18043164] . :gi18043164 a affx:Transcript ; affx:unigene "iMm.103439" ; affx:translatesTo "MFLVLERKMRTHQVFPLPLLLVIASVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKDKERKRPVCLHFLFLLGTLGLFGLTFAFIIQMDETICSIRRFLWGVLFALCFSCLLSQAWRVRRLVRQGTSPASWQLVSLALCLMLVQVIIATEWLVLTVLRDTKPACAYEPMDFVMALIYDMVLLAITLAQSLFTLCGKFKRWKVNGAFILVTTFLSALIWVVWMTMYLFGNSLIKQGDAWSDPTLAITLAASGWVFVIFHAIPEIHYTLLPPLQENPPNYFDTSQPRMRETAFDEEMHLPRAYMENKAFSMDEHNAALRSAVGFSNGSLEQRSSSLGKKPSSLGNRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHHW" ; affx:hasCds [affx:startsAt "108620330" ; affx:stopsAt "108629816" ]; affx:hasExon [ affx:relatesToExon :Gene5881_e1; affx:cdsType "Partial" ; affx:cdsStart "108620330" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5881_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5881_e3; affx:cdsType "Partial" ; affx:cdsStop "108629816" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5881_e4; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "28" ; affx:spannedBy [ affx:startsAt "108629732" ; affx:stopsAt "108629816" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "6" ; affx:containsMotif [ affx:startsAt "57" ; affx:stopsAt "79" ; affx:spannedBy [ affx:startsAt "108629579" ; affx:stopsAt "108629645" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "92" ; affx:stopsAt "114" ; affx:spannedBy [ affx:startsAt "108629474" ; affx:stopsAt "108629540" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "124" ; affx:stopsAt "142" ; affx:spannedBy [ affx:startsAt "108629390" ; affx:stopsAt "108629444" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "163" ; affx:stopsAt "185" ; affx:spannedBy [ affx:startsAt "108629261" ; affx:stopsAt "108629327" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "200" ; affx:stopsAt "222" ; affx:spannedBy [ affx:startsAt "108629150" ; affx:stopsAt "108629216" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "234" ; affx:stopsAt "256" ; affx:spannedBy [ affx:startsAt "108629048" ; affx:stopsAt "108629114" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5881_e1 a affx:Exon ; affx:startsAt "108618822" ; affx:stopsAt "108620375" ; affx:commonToAll "1" . :Gene5881_e2 a affx:Exon ; affx:startsAt "108621684" ; affx:stopsAt "108621842" ; affx:commonToAll "1" . :Gene5881_e3 a affx:Exon ; affx:startsAt "108628786" ; affx:stopsAt "108629817" ; affx:commonToAll "1" . :Gene5881_e4 a affx:Exon ; affx:startsAt "108640211" ; affx:stopsAt "108640323" ; affx:commonToAll "1" . :Glyt2 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi16305266] . :gi16305266 a affx:Transcript ; affx:unigene "iMm.207053" ; affx:translatesTo "MNKQPANILEAAVPGHRDSPRAPRTSPEQDLPAEAPTATVQPPRVPRSASTGAQTFQSADARACEAQQSGVGFCNLSSPRAQATSAALRDLSEGHSAQANPPSGPAGAGNALHCKIPALRGPEEDANVSVGKGTLEHNNTPAVGWVNMSQSTVVLGTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGPFLAQHRGERYKNMIDPLGTSSLGLKLPVKDLELGTQC" ; affx:hasCds [affx:startsAt "39535071" ; affx:stopsAt "39582860" ]; affx:hasExon [ affx:relatesToExon :Glyt2_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Glyt2_e2; affx:cdsType "Partial" ; affx:cdsStart "39535071" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Glyt2_e16; affx:cdsType "Partial" ; affx:cdsStop "39582860" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "12" ; affx:containsMotif [ affx:startsAt "219" ; affx:stopsAt "241" ; affx:spannedBy [ affx:startsAt "39538196" ; affx:stopsAt "39538200" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "39540578" ; affx:stopsAt "39540640" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "256" ; affx:stopsAt "278" ; affx:spannedBy [ affx:startsAt "39540685" ; affx:stopsAt "39540710" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "39540942" ; affx:stopsAt "39540983" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "280" ; affx:stopsAt "302" ; affx:spannedBy [ affx:startsAt "39540989" ; affx:stopsAt "39541055" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "384" ; affx:stopsAt "406" ; affx:spannedBy [ affx:startsAt "39553377" ; affx:stopsAt "39553443" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "427" ; affx:stopsAt "449" ; affx:spannedBy [ affx:startsAt "39559566" ; affx:stopsAt "39559632" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "464" ; affx:stopsAt "486" ; affx:spannedBy [ affx:startsAt "39561661" ; affx:stopsAt "39561727" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "499" ; affx:stopsAt "521" ; affx:spannedBy [ affx:startsAt "39564845" ; affx:stopsAt "39564911" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "555" ; affx:stopsAt "577" ; affx:spannedBy [ affx:startsAt "39568617" ; affx:stopsAt "39568671" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "39569563" ; affx:stopsAt "39569575" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "598" ; affx:stopsAt "620" ; affx:spannedBy [ affx:startsAt "39569638" ; affx:stopsAt "39569695" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "39571301" ; affx:stopsAt "39571310" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "630" ; affx:stopsAt "652" ; affx:spannedBy [ affx:startsAt "39571340" ; affx:stopsAt "39571401" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "39574731" ; affx:stopsAt "39574736" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "673" ; affx:stopsAt "692" ; affx:spannedBy [ affx:startsAt "39574799" ; affx:stopsAt "39574832" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "39579832" ; affx:stopsAt "39579856" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "707" ; affx:stopsAt "729" ; affx:spannedBy [ affx:startsAt "39579901" ; affx:stopsAt "39579967" ; affx:inFrame "1" ] ; ] ; ] ; . :Glyt2_e1 a affx:Exon ; affx:startsAt "39534118" ; affx:stopsAt "39534255" ; affx:commonToAll "1" . :Glyt2_e2 a affx:Exon ; affx:startsAt "39535050" ; affx:stopsAt "39535593" ; affx:commonToAll "1" . :Glyt2_e3 a affx:Exon ; affx:startsAt "39538061" ; affx:stopsAt "39538200" ; affx:commonToAll "1" . :Glyt2_e4 a affx:Exon ; affx:startsAt "39540578" ; affx:stopsAt "39540710" ; affx:commonToAll "1" . :Glyt2_e5 a affx:Exon ; affx:startsAt "39540942" ; affx:stopsAt "39541116" ; affx:commonToAll "1" . :Glyt2_e6 a affx:Exon ; affx:startsAt "39550914" ; affx:stopsAt "39551056" ; affx:commonToAll "1" . :Glyt2_e7 a affx:Exon ; affx:startsAt "39553334" ; affx:stopsAt "39553467" ; affx:commonToAll "1" . :Glyt2_e8 a affx:Exon ; affx:startsAt "39559527" ; affx:stopsAt "39559662" ; affx:commonToAll "1" . :Glyt2_e9 a affx:Exon ; affx:startsAt "39561646" ; affx:stopsAt "39561750" ; affx:commonToAll "1" . :Glyt2_e10 a affx:Exon ; affx:startsAt "39564829" ; affx:stopsAt "39564954" ; affx:commonToAll "1" . :Glyt2_e11 a affx:Exon ; affx:startsAt "39568558" ; affx:stopsAt "39568671" ; affx:commonToAll "1" . :Glyt2_e12 a affx:Exon ; affx:startsAt "39569563" ; affx:stopsAt "39569695" ; affx:commonToAll "1" . :Glyt2_e13 a affx:Exon ; affx:startsAt "39571301" ; affx:stopsAt "39571401" ; affx:commonToAll "1" . :Glyt2_e14 a affx:Exon ; affx:startsAt "39574731" ; affx:stopsAt "39574832" ; affx:commonToAll "1" . :Glyt2_e15 a affx:Exon ; affx:startsAt "39579832" ; affx:stopsAt "39580000" ; affx:commonToAll "1" . :Glyt2_e16 a affx:Exon ; affx:startsAt "39582704" ; affx:stopsAt "39583612" ; affx:commonToAll "1" . :Gene5883 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi12805266] . :gi12805266 a affx:Transcript ; affx:unigene "iMm.1893" ; affx:translatesTo "MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHRQLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR" ; affx:hasCds [affx:startsAt "87142719" ; affx:stopsAt "87150201" ]; affx:hasExon [ affx:relatesToExon :Gene5883_e1; affx:cdsType "Partial" ; affx:cdsStart "87142719" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5883_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5883_e3; affx:cdsType "Partial" ; affx:cdsStop "87150201" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "57" ; affx:stopsAt "76" ; affx:spannedBy [ affx:startsAt "87149400" ; affx:stopsAt "87149457" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5883_e1 a affx:Exon ; affx:startsAt "87142622" ; affx:stopsAt "87142888" ; affx:commonToAll "1" . :Gene5883_e2 a affx:Exon ; affx:startsAt "87149398" ; affx:stopsAt "87149542" ; affx:commonToAll "1" . :Gene5883_e3 a affx:Exon ; affx:startsAt "87150151" ; affx:stopsAt "87150330" ; affx:commonToAll "1" . :Gene5884 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18071669] . :gi18071669 a affx:Transcript ; affx:unigene "iMm.28764" ; affx:translatesTo "MAHLFKEKSNCYFCFRCLESPVYLNCGYICCLKCLDSLEKSPEGDGVLCPTCSVVSLKEDIIHAKQLGALVTKIKNLEPQLNFILTMDQGMKIFQVTMTLDVDTAQNHLIISDDLLSVYYTPQKQARKKCAERFHPSPCVLGSSRFTSGRHYWEVVVGTSKEWDIGICKESINRKKAIHLSEKNGFWTVGVRAKKVYSASTDPLTVLRVNPRLRRVGIFLDMLEKSVSFWDLSDGSHIYTFLEIPDTDPFRPFFSPASSYPDGDQEQVLSICPVTNPGIFGIPVNPQ" ; affx:hasCds [affx:startsAt "4471046" ; affx:stopsAt "4476299" ]; affx:hasExon [ affx:relatesToExon :Gene5884_e1; affx:cdsType "Partial" ; affx:cdsStart "4471046" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5884_e2; affx:cdsType "Partial" ; affx:cdsStop "4476299" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5884_e3; affx:cdsType "None" ] ; . :Gene5884_e1 a affx:Exon ; affx:startsAt "4470595" ; affx:stopsAt "4471624" ; affx:commonToAll "1" . :Gene5884_e2 a affx:Exon ; affx:startsAt "4476013" ; affx:stopsAt "4476308" ; affx:commonToAll "1" . :Gene5884_e3 a affx:Exon ; affx:startsAt "4477367" ; affx:stopsAt "4477626" ; affx:commonToAll "1" . :Gene5885 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13097347] . :gi13097347 a affx:Transcript ; affx:unigene "iMm.988" ; affx:translatesTo "MKLLSRAGSFSRFYSLKVAPKVKTSAAPGGVPLQPQDLEFTKLPNGLVIASLENYAPLSRIGLFVKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVEGIRSDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNSQTRIIENLHDVAYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSVLKQVAEQFLNMRGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIKRGNNTTSLLSQSVAKGSHQPFDVSAFNASYSDSGLFGIYTISQAAAAGEVINAAYNQVKAVAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALAAGSYMPPSTVLQQIDSVADADVVKAAKKFVSGKKSMAASGNLGHTPFLDEL" ; affx:hasCds [affx:startsAt "110280236" ; affx:stopsAt "110304052" ]; affx:hasExon [ affx:relatesToExon :Gene5885_e1; affx:cdsType "Partial" ; affx:cdsStart "110280236" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5885_e14; affx:cdsType "Partial" ; affx:cdsStop "110304052" ; affx:frame "1"] ; . :Gene5885_e1 a affx:Exon ; affx:startsAt "110280175" ; affx:stopsAt "110280269" ; affx:commonToAll "1" . :Gene5885_e2 a affx:Exon ; affx:startsAt "110282608" ; affx:stopsAt "110282692" ; affx:commonToAll "1" . :Gene5885_e3 a affx:Exon ; affx:startsAt "110282794" ; affx:stopsAt "110282944" ; affx:commonToAll "1" . :Gene5885_e4 a affx:Exon ; affx:startsAt "110285180" ; affx:stopsAt "110285245" ; affx:commonToAll "1" . :Gene5885_e5 a affx:Exon ; affx:startsAt "110286625" ; affx:stopsAt "110286682" ; affx:commonToAll "1" . :Gene5885_e6 a affx:Exon ; affx:startsAt "110287972" ; affx:stopsAt "110288097" ; affx:commonToAll "1" . :Gene5885_e7 a affx:Exon ; affx:startsAt "110290097" ; affx:stopsAt "110290195" ; affx:commonToAll "1" . :Gene5885_e8 a affx:Exon ; affx:startsAt "110294292" ; affx:stopsAt "110294350" ; affx:commonToAll "1" . :Gene5885_e9 a affx:Exon ; affx:startsAt "110295780" ; affx:stopsAt "110295876" ; affx:commonToAll "1" . :Gene5885_e10 a affx:Exon ; affx:startsAt "110296131" ; affx:stopsAt "110296331" ; affx:commonToAll "1" . :Gene5885_e11 a affx:Exon ; affx:startsAt "110298927" ; affx:stopsAt "110299008" ; affx:commonToAll "1" . :Gene5885_e12 a affx:Exon ; affx:startsAt "110301047" ; affx:stopsAt "110301124" ; affx:commonToAll "1" . :Gene5885_e13 a affx:Exon ; affx:startsAt "110302464" ; affx:stopsAt "110302618" ; affx:commonToAll "1" . :Gene5885_e14 a affx:Exon ; affx:startsAt "110303968" ; affx:stopsAt "110304166" ; affx:commonToAll "1" . :Gene5886 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13097359] . :gi13097359 a affx:Transcript ; affx:unigene "iMm.29381" ; affx:translatesTo "MSLRAKTCPQRREMASATSGPGRCVSKGGLGRRPPLARVRVAVRLRPFMDGETEAKELPCVRAIDSCSLEVANWKKYQETLKYQFDAFYGEKSTQQEVYVGSVQPILRHLLEGQNASVLAYGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLAREESAEGRPWDVSVAMSYLEIYQEKVLDLLDPASGDLVIREDCRGNILIPGLTQKPITSFSDFEQHFLPASRNRAVGATRLNQRSSRSHAVLLVKVDQRERLTPFRQREGKLYLIDLAGSEDNRRTGNQGIRLKESGAINTSLFVLGKVVDALNQGLPRIPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFYQDTISALNFTARSKEVINRPFTNESLQPHALAPVKLSQKELLGPSEAKKAKGPEEESTGSPESTAAPASASQKLSLLQKLSNMDPAMLENLLSMERLLGSQGSQGTPLLNTPKRERMVLMKTVEEKNLEIERLKMKQKELEAKVLAQEAPDPREKENTPTILQPPASYSGTVAKPLKKAVVMPLQRIQKQRESSNQIQLLKKGPKRKLEPSPESEAVEKDEDYWEVQISPELLAHGRKKLLDLLNEGSARELRSLQRIGQKKAQLIVGWRELHGPFSEVEDLEQVEGISGKQVESFLKANLLSLAASQHSGPS" ; affx:hasCds [affx:startsAt "116882220" ; affx:stopsAt "116896822" ]; affx:hasExon [ affx:relatesToExon :Gene5886_e1; affx:cdsType "Partial" ; affx:cdsStart "116882220" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5886_e14; affx:cdsType "Partial" ; affx:cdsStop "116896822" ; affx:frame "0"] ; . :Gene5886_e1 a affx:Exon ; affx:startsAt "116882158" ; affx:stopsAt "116882268" ; affx:commonToAll "1" . :Gene5886_e2 a affx:Exon ; affx:startsAt "116882358" ; affx:stopsAt "116882418" ; affx:commonToAll "1" . :Gene5886_e3 a affx:Exon ; affx:startsAt "116882497" ; affx:stopsAt "116882710" ; affx:commonToAll "1" . :Gene5886_e4 a affx:Exon ; affx:startsAt "116883342" ; affx:stopsAt "116883404" ; affx:commonToAll "1" . :Gene5886_e5 a affx:Exon ; affx:startsAt "116883762" ; affx:stopsAt "116883928" ; affx:commonToAll "1" . :Gene5886_e6 a affx:Exon ; affx:startsAt "116885356" ; affx:stopsAt "116885525" ; affx:commonToAll "1" . :Gene5886_e7 a affx:Exon ; affx:startsAt "116887056" ; affx:stopsAt "116887192" ; affx:commonToAll "1" . :Gene5886_e8 a affx:Exon ; affx:startsAt "116887309" ; affx:stopsAt "116887463" ; affx:commonToAll "1" . :Gene5886_e9 a affx:Exon ; affx:startsAt "116887589" ; affx:stopsAt "116887820" ; affx:commonToAll "1" . :Gene5886_e10 a affx:Exon ; affx:startsAt "116887896" ; affx:stopsAt "116888106" ; affx:commonToAll "1" . :Gene5886_e11 a affx:Exon ; affx:startsAt "116888305" ; affx:stopsAt "116888460" ; affx:commonToAll "1" . :Gene5886_e12 a affx:Exon ; affx:startsAt "116888551" ; affx:stopsAt "116888679" ; affx:commonToAll "1" . :Gene5886_e13 a affx:Exon ; affx:startsAt "116890175" ; affx:stopsAt "116890368" ; affx:commonToAll "1" . :Gene5886_e14 a affx:Exon ; affx:startsAt "116896764" ; affx:stopsAt "116896841" ; affx:commonToAll "1" . :Gene5887 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi17391086] . :gi17391086 a affx:Transcript ; affx:unigene "iMm.41516" ; affx:translatesTo "MNDRNNRWRTMKDEETFEISIPFEEAPHLDSQILYRLSPSRRNVEEPPEGASPTLALMSSVKAQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMDAEDYCRMKPGPRRVDGDSRAGVGEASDPESAASSFSGVSEDGSASERKRQKQKGSTSRKRFGKTKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR" ; affx:hasCds [affx:startsAt "4417154" ; affx:stopsAt "4420049" ]; affx:hasExon [ affx:relatesToExon :Gene5887_e1; affx:cdsType "Partial" ; affx:cdsStart "4417154" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5887_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5887_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5887_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5887_e5; affx:cdsType "Partial" ; affx:cdsStop "4420049" ; affx:frame "0"] ; . :Gene5887_e1 a affx:Exon ; affx:startsAt "4416722" ; affx:stopsAt "4417185" ; affx:commonToAll "1" . :Gene5887_e2 a affx:Exon ; affx:startsAt "4417324" ; affx:stopsAt "4417429" ; affx:commonToAll "1" . :Gene5887_e3 a affx:Exon ; affx:startsAt "4417517" ; affx:stopsAt "4417694" ; affx:commonToAll "1" . :Gene5887_e4 a affx:Exon ; affx:startsAt "4419021" ; affx:stopsAt "4419231" ; affx:commonToAll "1" . :Gene5887_e5 a affx:Exon ; affx:startsAt "4419732" ; affx:stopsAt "4420311" ; affx:commonToAll "1" . :Gene5888 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi17160900] . :gi17160900 a affx:Transcript ; affx:unigene "iMm.34754" ; affx:translatesTo "MTVARWLRLWERGQAMLHVTWGSKVRLWSLVPALLGTPRALSSLENRMGVYRKMWNPKEPCDWAQQYRERFIPFSKEQLLRLLIQEFHSSPAERAALEAFSAHVDFCTLFHYHQLLARLQALYDPINPDRETLDQPSLTDPERLSSEKDVLQALRPLLAQANFSPLSEDALAYALVVHHPQDEVQVTINLDQYIYIQFWALGQRVGQMPHKSSVGSKRGFFRKLPPVERRYFKRVVLAARTKGGHLVLKSFKDTPLEGLEQLLPELKVRTPVLQRALLNLMLVVSGVMIFVNVGMVILSDLKMATSLLLLLFAAFMGVKASKVFGQRRSAQALELAHVLYYRSTSNNSELLSALALRAQEEHIKEALLAHSFLARRPGGSQGKPEETSRWLQSEVESWLLAQSGCDVTFNGPRALAHLQALTPSLGLFPPPELPQLDPMVLGTPEATQAALGSSYPSP" ; affx:hasCds [affx:startsAt "35473136" ; affx:stopsAt "35493099" ]; affx:hasExon [ affx:relatesToExon :Gene5888_e1; affx:cdsType "Partial" ; affx:cdsStart "35473136" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5888_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5888_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5888_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5888_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5888_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5888_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5888_e8; affx:cdsType "Partial" ; affx:cdsStop "35493099" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "42" ; affx:spannedBy [ affx:startsAt "35473136" ; affx:stopsAt "35473159" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "35473492" ; affx:stopsAt "35473595" ; affx:inFrame "2" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "276" ; affx:stopsAt "298" ; affx:spannedBy [ affx:startsAt "35485931" ; affx:stopsAt "35485997" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "303" ; affx:stopsAt "325" ; affx:spannedBy [ affx:startsAt "35486012" ; affx:stopsAt "35486069" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "35492550" ; affx:stopsAt "35492559" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5888_e1 a affx:Exon ; affx:startsAt "35473132" ; affx:stopsAt "35473159" ; affx:commonToAll "1" . :Gene5888_e2 a affx:Exon ; affx:startsAt "35473492" ; affx:stopsAt "35473724" ; affx:commonToAll "1" . :Gene5888_e3 a affx:Exon ; affx:startsAt "35475690" ; affx:stopsAt "35475795" ; affx:commonToAll "1" . :Gene5888_e4 a affx:Exon ; affx:startsAt "35483385" ; affx:stopsAt "35483580" ; affx:commonToAll "1" . :Gene5888_e5 a affx:Exon ; affx:startsAt "35484574" ; affx:stopsAt "35484705" ; affx:commonToAll "1" . :Gene5888_e6 a affx:Exon ; affx:startsAt "35485789" ; affx:stopsAt "35486069" ; affx:commonToAll "1" . :Gene5888_e7 a affx:Exon ; affx:startsAt "35492550" ; affx:stopsAt "35492740" ; affx:commonToAll "1" . :Gene5888_e8 a affx:Exon ; affx:startsAt "35492878" ; affx:stopsAt "35493881" ; affx:commonToAll "1" . :Gene5889 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi17160867] . :gi17160867 a affx:Transcript ; affx:unigene "iMm.27567" ; affx:translatesTo "MEGSSYRVVFEKGGVYLHTSARKHQDPDSLIAGVIRVVEKDSDVFLHWAPVEEAGDPTQILFKKDPSRGEPSTSEEEPTFDPGYEPDWAVISTVRPQPHLAEPRKGAEPSSSRSSWAFSVSLGELKSIRRSKPGLSWAYLVLVTQAGGSLPALHFHRGGTRALLRVLSRYLLLASSPQDSRLYLVFPQDPSALSDSFHHLQLFDQDSSNVVSRFLQDPYSTTFSSFSRVTNFFRGALQPHPEGASSPNLPPLPDDEPEPGFEVISCVELGQRPTVERAPPVTEEEWNRYVGPEGRLQNVPELKNRIFSGGLSPGLRREAWKFLLGYLSWESSAEEHKAHVRKKTDEYFRMKLQWKSVSAEQERRNSLLHGYRSLIERDVSRTDRTNKFYEGPENPGLSLLHDILLTYCMYHFDLGYVQGMSDLLSPILFVVQNEVDAFWCFCGFMELVHGNFEESQETMKRQLGQLLLLLRVLDQPLCDFLDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVGGQLGCCGQGFLAPICTCWWPVPSWIWNGTP" ; affx:hasCds [affx:startsAt "34407996" ; affx:stopsAt "34414848" ]; affx:hasExon [ affx:relatesToExon :Gene5889_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5889_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5889_e3; affx:cdsType "Partial" ; affx:cdsStart "34407996" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5889_e17; affx:cdsType "Partial" ; affx:cdsStop "34414848" ; affx:frame "2"] ; . :Gene5889_e1 a affx:Exon ; affx:startsAt "34407010" ; affx:stopsAt "34407399" ; affx:commonToAll "1" . :Gene5889_e2 a affx:Exon ; affx:startsAt "34407521" ; affx:stopsAt "34407608" ; affx:commonToAll "1" . :Gene5889_e3 a affx:Exon ; affx:startsAt "34407961" ; affx:stopsAt "34408078" ; affx:commonToAll "1" . :Gene5889_e4 a affx:Exon ; affx:startsAt "34408164" ; affx:stopsAt "34408279" ; affx:commonToAll "1" . :Gene5889_e5 a affx:Exon ; affx:startsAt "34408599" ; affx:stopsAt "34408699" ; affx:commonToAll "1" . :Gene5889_e6 a affx:Exon ; affx:startsAt "34408794" ; affx:stopsAt "34408895" ; affx:commonToAll "1" . :Gene5889_e7 a affx:Exon ; affx:startsAt "34408973" ; affx:stopsAt "34409090" ; affx:commonToAll "1" . :Gene5889_e8 a affx:Exon ; affx:startsAt "34409410" ; affx:stopsAt "34409505" ; affx:commonToAll "1" . :Gene5889_e9 a affx:Exon ; affx:startsAt "34410062" ; affx:stopsAt "34410166" ; affx:commonToAll "1" . :Gene5889_e10 a affx:Exon ; affx:startsAt "34410249" ; affx:stopsAt "34410378" ; affx:commonToAll "1" . :Gene5889_e11 a affx:Exon ; affx:startsAt "34410990" ; affx:stopsAt "34411152" ; affx:commonToAll "1" . :Gene5889_e12 a affx:Exon ; affx:startsAt "34411235" ; affx:stopsAt "34411347" ; affx:commonToAll "1" . :Gene5889_e13 a affx:Exon ; affx:startsAt "34411853" ; affx:stopsAt "34412061" ; affx:commonToAll "1" . :Gene5889_e14 a affx:Exon ; affx:startsAt "34412739" ; affx:stopsAt "34412863" ; affx:commonToAll "1" . :Gene5889_e15 a affx:Exon ; affx:startsAt "34414248" ; affx:stopsAt "34414320" ; affx:commonToAll "1" . :Gene5889_e16 a affx:Exon ; affx:startsAt "34414414" ; affx:stopsAt "34414513" ; affx:commonToAll "1" . :Gene5889_e17 a affx:Exon ; affx:startsAt "34414827" ; affx:stopsAt "34415058" ; affx:commonToAll "1" . :Gene5890 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi17160951] . :gi17160951 a affx:Transcript ; affx:unigene "iMm.212981" ; affx:translatesTo "MAAGGNRDGEKRGSRSQADSGFLGLRPTSVDPALRRRRRGPRNKKRGWRRLAEEPLGLEVDQFLEDVRLQERTTGGLLAEAPNEKLFFVDTGFKRKEPRKKRTLVQKKSQRLQKPLRVDLALENHSKIPAPKDILAHQVPNAKKLRRKEELWEKLAKQGELPRDVRKAQARLLSPPTPKAKPGPQDIIERPFYDLWNPDNPLDTPLIGQDAFFLEQTKKKGVRRPQRLHIKPSQVPAVEVIPAGASYNPTFEDHQALLREAHEVELQREKEAEKLERQLALPTSEQAATQESVFREMCEGLLEESDGEDEHEAGRAGQPEAGDGTTEISPTGAAGPEKRMEKKTEQQRRREKAARKLRVQQAALRAARLQHQELFRLRGIKAQVARRLAELARRREQRRIRRLAEADKPRRLGRLKYQAPDIDVQLSSELSGSLRTLKPEGHILRDRFKSFQKRNMIEPRERAKFKRKYKVKLVEKRAYREIQL" ; affx:hasCds [affx:startsAt "11069976" ; affx:stopsAt "11078222" ]; affx:hasExon [ affx:relatesToExon :Gene5890_e1; affx:cdsType "Partial" ; affx:cdsStart "11069976" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5890_e13; affx:cdsType "Partial" ; affx:cdsStop "11078222" ; affx:frame "1"] ; . :Gene5890_e1 a affx:Exon ; affx:startsAt "11069928" ; affx:stopsAt "11069983" ; affx:commonToAll "1" . :Gene5890_e2 a affx:Exon ; affx:startsAt "11070267" ; affx:stopsAt "11070324" ; affx:commonToAll "1" . :Gene5890_e3 a affx:Exon ; affx:startsAt "11070515" ; affx:stopsAt "11070592" ; affx:commonToAll "1" . :Gene5890_e4 a affx:Exon ; affx:startsAt "11071074" ; affx:stopsAt "11071141" ; affx:commonToAll "1" . :Gene5890_e5 a affx:Exon ; affx:startsAt "11071252" ; affx:stopsAt "11071428" ; affx:commonToAll "1" . :Gene5890_e6 a affx:Exon ; affx:startsAt "11071617" ; affx:stopsAt "11071818" ; affx:commonToAll "1" . :Gene5890_e7 a affx:Exon ; affx:startsAt "11071892" ; affx:stopsAt "11071997" ; affx:commonToAll "1" . :Gene5890_e8 a affx:Exon ; affx:startsAt "11072301" ; affx:stopsAt "11072397" ; affx:commonToAll "1" . :Gene5890_e9 a affx:Exon ; affx:startsAt "11073903" ; affx:stopsAt "11073974" ; affx:commonToAll "1" . :Gene5890_e10 a affx:Exon ; affx:startsAt "11074338" ; affx:stopsAt "11074538" ; affx:commonToAll "1" . :Gene5890_e11 a affx:Exon ; affx:startsAt "11074952" ; affx:stopsAt "11075061" ; affx:commonToAll "1" . :Gene5890_e12 a affx:Exon ; affx:startsAt "11077458" ; affx:stopsAt "11077523" ; affx:commonToAll "1" . :Gene5890_e13 a affx:Exon ; affx:startsAt "11077998" ; affx:stopsAt "11078227" ; affx:commonToAll "1" . :Gene5891 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi17390585] . :gi17390585 a affx:Transcript ; affx:unigene "iMm.103669" ; affx:translatesTo "MQFPMGPACIFLRKGIAEKQRERPLGQDELDELREAFLEFDKDQDGFISYKDLGNLMRTMGYMPTEMELTELGQQIRMNLGGRVDFEDFVELMTPKLLAETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGEKLTPREIAEVVQEADINGDGTVDFEEFVKMMSR" ; affx:hasCds [affx:startsAt "9521415" ; affx:stopsAt "9530916" ]; affx:hasExon [ affx:relatesToExon :Gene5891_e1; affx:cdsType "Partial" ; affx:cdsStart "9521415" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5891_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5891_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5891_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5891_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5891_e6; affx:cdsType "Partial" ; affx:cdsStop "9530916" ; affx:frame "1"] ; . :Gene5891_e1 a affx:Exon ; affx:startsAt "9521239" ; affx:stopsAt "9521478" ; affx:commonToAll "1" . :Gene5891_e2 a affx:Exon ; affx:startsAt "9523812" ; affx:stopsAt "9523843" ; affx:commonToAll "1" . :Gene5891_e3 a affx:Exon ; affx:startsAt "9524338" ; affx:stopsAt "9524482" ; affx:commonToAll "1" . :Gene5891_e4 a affx:Exon ; affx:startsAt "9526415" ; affx:stopsAt "9526525" ; affx:commonToAll "1" . :Gene5891_e5 a affx:Exon ; affx:startsAt "9528507" ; affx:stopsAt "9528655" ; affx:commonToAll "1" . :Gene5891_e6 a affx:Exon ; affx:startsAt "9530890" ; affx:stopsAt "9531997" ; affx:commonToAll "1" . :Gene5892 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi17028421] . :gi17028421 a affx:Transcript ; affx:unigene "iMm.41446" ; affx:translatesTo "MGGEAGADGPRGRVKSLGLVFEDESKGCYSSGETVAGHVLLEAAEPVALRGLRLEAQGRATSAWGPSAGARVCIGGGSPAASSEVEYLNLRLSLLEAPAGEGVTLLQPGKHEFPFRFQLPSEPLATSFTGKYGSIQYCVRAVLERPQVPDQSVRRELQVVSHVDVNTPPLLTPMLKTQEKMVGCWLFTSGPVSLSVKIERKGYCNGEAIPIYAEIENCSSRLVVPKAAIFQTQTYLASGKTKTVRHMVANVRGNHIGSGSTDTWNGKMLKIPPVTPSILDCCIIRVDYSLAVIQAS" ; affx:hasCds [affx:startsAt "58175112" ; affx:stopsAt "58182573" ]; affx:hasExon [ affx:relatesToExon :Gene5892_e1; affx:cdsType "Partial" ; affx:cdsStart "58175112" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5892_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5892_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5892_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5892_e5; affx:cdsType "Partial" ; affx:cdsStop "58182573" ; affx:frame "0"] ; . :Gene5892_e1 a affx:Exon ; affx:startsAt "58175088" ; affx:stopsAt "58175387" ; affx:commonToAll "1" . :Gene5892_e2 a affx:Exon ; affx:startsAt "58176057" ; affx:stopsAt "58176160" ; affx:commonToAll "1" . :Gene5892_e3 a affx:Exon ; affx:startsAt "58178383" ; affx:stopsAt "58178531" ; affx:commonToAll "1" . :Gene5892_e4 a affx:Exon ; affx:startsAt "58178746" ; affx:stopsAt "58178813" ; affx:commonToAll "1" . :Gene5892_e5 a affx:Exon ; affx:startsAt "58182275" ; affx:stopsAt "58182695" ; affx:commonToAll "1" . :Gene5893 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi1695699] . :gi1695699 a affx:Transcript ; affx:unigene "iMm.17235" ; affx:translatesTo "MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGFGQGAGCLSTDTGEHLGLQFQQSPKPARAATTSNPSKFSAKFGESEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE" ; affx:hasCds [affx:startsAt "38451213" ; affx:stopsAt "38460116" ]; affx:hasExon [ affx:relatesToExon :Gene5893_e1; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5893_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5893_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5893_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5893_e5; affx:cdsType "Full" ; affx:frame "0"] ; . :Gene5893_e1 a affx:Exon ; affx:startsAt "38451213" ; affx:stopsAt "38451290" ; affx:commonToAll "1" . :Gene5893_e2 a affx:Exon ; affx:startsAt "38453145" ; affx:stopsAt "38453239" ; affx:commonToAll "1" . :Gene5893_e3 a affx:Exon ; affx:startsAt "38454322" ; affx:stopsAt "38454455" ; affx:commonToAll "1" . :Gene5893_e4 a affx:Exon ; affx:startsAt "38456050" ; affx:stopsAt "38456219" ; affx:commonToAll "1" . :Gene5893_e5 a affx:Exon ; affx:startsAt "38460004" ; affx:stopsAt "38460116" ; affx:commonToAll "1" . :Gene5894 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18605653] . :gi18605653 a affx:Transcript ; affx:unigene "iMm.175032" ; affx:translatesTo "MNILPKKSWHVRNKDNVARVRRDEAQAREEEKERERRVLLAQQEARTEFLRKKARQRNSVPELEAADPGAPSSGPVDLFRELLEERKGVPRGNKEHEEEKRREKERQEKALGILTYLGQSAAEAQTQPPWYQLPPGQKDCCPPGPSPDEKIKNRLDPLKEMQKHLAKKRHSSESRPSREERPQKQRPREPPSLEKLRAERLQREAAERARAEALLARVQGQVSQQGQVEAEETDERRRRYNSQFNPQLARRPRQQNPTPAH" ; affx:hasCds [affx:startsAt "3096207" ; affx:stopsAt "3100528" ]; affx:hasExon [ affx:relatesToExon :Gene5894_e1; affx:cdsType "Partial" ; affx:cdsStart "3096207" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5894_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5894_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5894_e4; affx:cdsType "Partial" ; affx:cdsStop "3100528" ; affx:frame "2"] ; . :Gene5894_e1 a affx:Exon ; affx:startsAt "3095171" ; affx:stopsAt "3096427" ; affx:commonToAll "1" . :Gene5894_e2 a affx:Exon ; affx:startsAt "3097851" ; affx:stopsAt "3098105" ; affx:commonToAll "1" . :Gene5894_e3 a affx:Exon ; affx:startsAt "3098762" ; affx:stopsAt "3098942" ; affx:commonToAll "1" . :Gene5894_e4 a affx:Exon ; affx:startsAt "3100396" ; affx:stopsAt "3100921" ; affx:commonToAll "1" . :Gene5895 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18256833] . :gi18256833 a affx:Transcript ; affx:unigene "iMm.196580" ; affx:translatesTo "MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK" ; affx:hasCds [affx:startsAt "9151323" ; affx:stopsAt "9153439" ]; affx:hasExon [ affx:relatesToExon :Gene5895_e1; affx:cdsType "Partial" ; affx:cdsStart "9151323" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5895_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5895_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5895_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5895_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5895_e6; affx:cdsType "Partial" ; affx:cdsStop "9153439" ; affx:frame "0"] ; . :Gene5895_e1 a affx:Exon ; affx:startsAt "9150947" ; affx:stopsAt "9151464" ; affx:commonToAll "1" . :Gene5895_e2 a affx:Exon ; affx:startsAt "9151551" ; affx:stopsAt "9151615" ; affx:commonToAll "1" . :Gene5895_e3 a affx:Exon ; affx:startsAt "9151921" ; affx:stopsAt "9152025" ; affx:commonToAll "1" . :Gene5895_e4 a affx:Exon ; affx:startsAt "9152143" ; affx:stopsAt "9152182" ; affx:commonToAll "1" . :Gene5895_e5 a affx:Exon ; affx:startsAt "9152275" ; affx:stopsAt "9152370" ; affx:commonToAll "1" . :Gene5895_e6 a affx:Exon ; affx:startsAt "9153330" ; affx:stopsAt "9153685" ; affx:commonToAll "1" . :Gene5896 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18490758] . :gi18490758 a affx:Transcript ; affx:unigene "iMm.24413" ; affx:translatesTo "MAAVVEVEVGGGALAERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHAEMVLILIATLVVAQLLLVQWKQRHPRSYNMVTLFQMWVVPLYFTVKLHWWRFLVIWIFFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATGIVGYMAVMFTLFGLNLLFKIKPEDAMDFGISLLFYGLYYGVLERDFAEMCADYMASTIGFYSESGMPTKHLSNSVCAVCGQQIFVDVNEEGIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMFSNPWERPHVMYGQLLDWLRYLVAWQPVIIGLVQGISYILGLE" ; affx:hasCds [affx:startsAt "91846153" ; affx:stopsAt "91890851" ]; affx:hasExon [ affx:relatesToExon :Gene5896_e1; affx:cdsType "Partial" ; affx:cdsStart "91846153" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5896_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5896_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5896_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5896_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5896_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5896_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5896_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5896_e9; affx:cdsType "Partial" ; affx:cdsStop "91890851" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "6" ; affx:containsMotif [ affx:startsAt "50" ; affx:stopsAt "72" ; affx:spannedBy [ affx:startsAt "91865185" ; affx:stopsAt "91865251" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "79" ; affx:stopsAt "96" ; affx:spannedBy [ affx:startsAt "91865158" ; affx:stopsAt "91865164" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "91861025" ; affx:stopsAt "91861070" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "101" ; affx:stopsAt "120" ; affx:spannedBy [ affx:startsAt "91860953" ; affx:stopsAt "91861010" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "140" ; affx:stopsAt "162" ; affx:spannedBy [ affx:startsAt "91857122" ; affx:stopsAt "91857188" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "175" ; affx:stopsAt "192" ; affx:spannedBy [ affx:startsAt "91854671" ; affx:stopsAt "91854722" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "302" ; affx:stopsAt "324" ; affx:spannedBy [ affx:startsAt "91846165" ; affx:stopsAt "91846231" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5896_e1 a affx:Exon ; affx:startsAt "91845653" ; affx:stopsAt "91846274" ; affx:commonToAll "1" . :Gene5896_e2 a affx:Exon ; affx:startsAt "91849093" ; affx:stopsAt "91849195" ; affx:commonToAll "1" . :Gene5896_e3 a affx:Exon ; affx:startsAt "91849794" ; affx:stopsAt "91849928" ; affx:commonToAll "1" . :Gene5896_e4 a affx:Exon ; affx:startsAt "91854620" ; affx:stopsAt "91854741" ; affx:commonToAll "1" . :Gene5896_e5 a affx:Exon ; affx:startsAt "91857102" ; affx:stopsAt "91857210" ; affx:commonToAll "1" . :Gene5896_e6 a affx:Exon ; affx:startsAt "91860915" ; affx:stopsAt "91861070" ; affx:commonToAll "1" . :Gene5896_e7 a affx:Exon ; affx:startsAt "91865158" ; affx:stopsAt "91865300" ; affx:commonToAll "1" . :Gene5896_e8 a affx:Exon ; affx:startsAt "91868235" ; affx:stopsAt "91868273" ; affx:commonToAll "1" . :Gene5896_e9 a affx:Exon ; affx:startsAt "91890788" ; affx:stopsAt "91890855" ; affx:commonToAll "1" . :Gene5897 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18605680] . :gi18605680 a affx:Transcript ; affx:unigene "iMm.36766" ; affx:translatesTo "MFEEPEWVEAAPAIVGLGAATAQVRPATAPPVKGRKRRHLLATLRALEAASLSQQTPSLPGSDSEEEEEVGRKKRHLQRPSLASVSKEVGKKRKGKCQKQAPSISDSEGKEIRRKCHRQAPPLGGVSAGEEKGKRKCQEYSSLHLTQPLDSVDQTVHNSRTSTATIDPSKPSPESMSPNSSHTLSRKQWRNRQKNKRRHKNKFRPLQTPEQAPPKASIEETEVPPVPKSDSQESRAGALRARMTQRLDGARFRYLNEQLYSGPSSAARRLFQEDPEAFLLYHRGFQRQVKKWPLHPVDRIAKDLRQKPASLVVADFGCGDCRLASSVRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKTGGLLKVAEVSSRFEDIRTFLGAVTKLGFKIIYKDLTNSHFFLFDFEKTGPPRVGPKAQLSGLKLQPCLYKRR" ; affx:hasCds [affx:startsAt "95502629" ; affx:stopsAt "95506002" ]; affx:hasExon [ affx:relatesToExon :Gene5897_e1; affx:cdsType "Partial" ; affx:cdsStart "95502629" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5897_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5897_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5897_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5897_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5897_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5897_e7; affx:cdsType "Partial" ; affx:cdsStop "95506002" ; affx:frame "2"] ; . :Gene5897_e1 a affx:Exon ; affx:startsAt "95501808" ; affx:stopsAt "95502749" ; affx:commonToAll "1" . :Gene5897_e2 a affx:Exon ; affx:startsAt "95502957" ; affx:stopsAt "95503054" ; affx:commonToAll "1" . :Gene5897_e3 a affx:Exon ; affx:startsAt "95503137" ; affx:stopsAt "95503244" ; affx:commonToAll "1" . :Gene5897_e4 a affx:Exon ; affx:startsAt "95503373" ; affx:stopsAt "95503503" ; affx:commonToAll "1" . :Gene5897_e5 a affx:Exon ; affx:startsAt "95503605" ; affx:stopsAt "95504059" ; affx:commonToAll "1" . :Gene5897_e6 a affx:Exon ; affx:startsAt "95504295" ; affx:stopsAt "95504662" ; affx:commonToAll "1" . :Gene5897_e7 a affx:Exon ; affx:startsAt "95505903" ; affx:stopsAt "95506122" ; affx:commonToAll "1" . :Gene5898 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18490558] . :gi18490558 a affx:Transcript ; affx:unigene "iMm.87738" ; affx:translatesTo "MLFHLSGLYSALYFLATLLMIVYKSQVFSYPCNCLALDLVLLLLMGILKVAQLYLGTKGNLMEAEVPLAASLAFTAVGGLLSVHFLLWQTLVLWMDSVLSTVLLVLHGLEAGLQVVVIADFIR" ; affx:hasCds [affx:startsAt "131587572" ; affx:stopsAt "131589964" ]; affx:hasExon [ affx:relatesToExon :Gene5898_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5898_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5898_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5898_e4; affx:cdsType "Partial" ; affx:cdsStart "131587572" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5898_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5898_e6; affx:cdsType "Partial" ; affx:cdsStop "131589964" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "53" ; affx:spannedBy [ affx:startsAt "131587572" ; affx:stopsAt "131587645" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "131587924" ; affx:stopsAt "131588010" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "66" ; affx:stopsAt "88" ; affx:spannedBy [ affx:startsAt "131589790" ; affx:stopsAt "131589856" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "97" ; affx:stopsAt "119" ; affx:spannedBy [ affx:startsAt "131589883" ; affx:stopsAt "131589949" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene5898_e1 a affx:Exon ; affx:startsAt "131581926" ; affx:stopsAt "131582007" ; affx:commonToAll "1" . :Gene5898_e2 a affx:Exon ; affx:startsAt "131585282" ; affx:stopsAt "131585426" ; affx:commonToAll "1" . :Gene5898_e3 a affx:Exon ; affx:startsAt "131586823" ; affx:stopsAt "131586843" ; affx:commonToAll "1" . :Gene5898_e4 a affx:Exon ; affx:startsAt "131587551" ; affx:stopsAt "131587645" ; affx:commonToAll "1" . :Gene5898_e5 a affx:Exon ; affx:startsAt "131587924" ; affx:stopsAt "131588017" ; affx:commonToAll "1" . :Gene5898_e6 a affx:Exon ; affx:startsAt "131589758" ; affx:stopsAt "131590743" ; affx:commonToAll "1" . :Gene5899 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18605631] . :gi18605631 a affx:Transcript ; affx:unigene "iMm.46282" ; affx:translatesTo "MLWMPVPPALTLGEEEKDRTWEFLTVVGSSQAEAQDCFAEALQLQTRGVLYTIHADSWGRLWAGCGLDVAGPLALRQALRGSLYYLFSELPQPGTQGFISHGLSPGGLSNGSKEECYWGHIFWDQDIWMFPNILMFHPEAARAILEYRVRTLGGALKNGQNLGYQGAKFAWESASTGLEVCPEDIYGTQEIHINGAVALAFQLYYYYTQDSKLFQEDGGWDVVSSVAEFWCSRVEWSSQDKMYHLKGVMPPDEYHSGVNNSVYTNVLVQNSLHFAAALAKDLGLPIRKQWLEVADRIKIPFDSEQNFHPEFDGYERGEEVKQADVVLLGYPVPFPLTPDIRRKNLETYEAVTSPQGPAMTWSMFAVGWMELRDPSRAQVHLSRSFANVTEPFKVWTENADGSGAVNFLTGMGGFLQAALFGCTGFRITEAGVTFDPLCPDLVSRVSVSGISYLGNKINFAFSKDSVTLEVTARAEPWAPLLEAELWPSLAHLPLTPEGLLSPLSWPDTKVIPIAAQKFFRGS" ; affx:hasCds [affx:startsAt "131195991" ; affx:stopsAt "131199527" ]; affx:hasExon [ affx:relatesToExon :Gene5899_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5899_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5899_e3; affx:cdsType "Partial" ; affx:cdsStart "131195991" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5899_e13; affx:cdsType "Partial" ; affx:cdsStop "131199527" ; affx:frame "0"] ; . :Gene5899_e1 a affx:Exon ; affx:startsAt "131195189" ; affx:stopsAt "131195219" ; affx:commonToAll "1" . :Gene5899_e2 a affx:Exon ; affx:startsAt "131195639" ; affx:stopsAt "131195850" ; affx:commonToAll "1" . :Gene5899_e3 a affx:Exon ; affx:startsAt "131195930" ; affx:stopsAt "131196366" ; affx:commonToAll "1" . :Gene5899_e4 a affx:Exon ; affx:startsAt "131197298" ; affx:stopsAt "13119