# Test data in notation3 http://www.w3.org/DesignIssues/Notation3.html # @prefix affx: . @prefix rdfs: . @prefix owl: . @prefix : <#> . affx:Gene a owl:Class ; owl:hasProperty affx:onStrand ; owl:hasProperty affx:onChr ; owl:hasProperty affx:hasVariant . affx:onStrand a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The strand on which the gene exists" . affx:onChr a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The chromosome on which the gene exists" . affx:hasVariant a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range affx:SpliceVariant ; owl:minCardinality "1" ; rdfs:comment "For associating variants to genes" . affx:SpliceVariant a owl:Class ; owl:hasProperty affx:representedBy . affx:representedBy a owl:ObjectProperty ; owl:domain affx:SpliceVariant ; owl:range affx:Transcript ; owl:minCardinality "1" ; rdfs:comment "In this data, each splice variant is represented by one transcript" . affx:Transcript a owl:Class ; owl:hasProperty affx:unigene ; owl:hasProperty affx:translatesTo ; owl:hasProperty affx:fullCds ; owl:hasProperty affx:hasExon ; owl:hasProperty affx:signalPHit ; owl:hasProperty affx:tmHMMHit ; rdfs:comment "A transcript has a CDS region, a protein translation, and exons" ; rdfs:comment "Additionally the transcript might have one or more annotations" . affx:unigene a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The Unigene ID of the transcript - and splice variant" . affx:translatesTo a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The amino acid sequence derived from the transcript" . affx:fullCds a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:GenomicCoordinates ; owl:cardinality "1" ; rdfs:comment "Start and stop coordinates of the full CDS region" . affx:hasExon a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:ExonPlusCds ; owl:minCardinality "1" ; rdfs:comment "Here, exons are defined only by their coordinates " . affx:ExonPlusCds a owl:Class ; owl:hasProperty affx:relatesToExon ; owl:hasProperty affx:cdsType ; owl:hasProperty affx:cdsStart ; owl:hasProperty affx:cdsStop ; owl:hasProperty affx:frame . affx:relatesToExon a owl:ObjectProperty ; owl:domain affx:ExonWithCds ; owl:range affx:Exon ; owl:cardinality "1" ; rdfs:comment "For associating exons with properties such as frame" . affx:Exon a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:commonToAll ; rdfs:comment "Defines the coordinates of an exon on the genome" . affx:GenomicSpan a owl:Class ; rdfs:subClassOf affx:GenomicCoordinates ; rdfs:comment "This defines a region of _ungapped_ genomic alignment" . affx:GenomicCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Start and stop, possibly with intervening gaps " ; rdfs:comment "Strand and chr will be specified at the gene level " . affx:Coordinates a owl:Class ; owl:hasProperty affx:startsAt ; owl:hasProperty affx:stopsAt . affx:startsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:stopsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:cdsType a owl:ObjectProperty ; owl:domain affx:ExonPlusCds ; owl:range rdfs:Literal ; rdfs:comment "Expected CDS types are Full, Partial, and None" . affx:commonToAll a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Shows if all the gene's variants share this object" . affx:CdsOccupancy a owl:Class ; rdfs:subClassOf rdfs:Literal . affx:cdsStart a owl:ObjectProperty ; rdfs:subClassOf affx:startsAt ; rdfs:comment "For indicating where a specific CDS region starts" . affx:cdsStop a owl:ObjectProperty ; rdfs:subClassOf affx:stopsAt ; rdfs:comment "For indicating where a specific CDS region stops" . affx:frame a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" . affx:signalPHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:SignalPeptide ; owl:cardinality "1" . affx:SignalPeptide a owl:Class ; rdfs:subClassOf affx:Annotation ; rdfs:comment "Represents a SIGNALP hit" . affx:tmHMMHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:Transmembrane ; owl:cardinality "1" . affx:Transmembrane a owl:Class ; rdfs:subClassOf affx:Annotation ; owl:hasProperty affx:helixCount ; rdfs:comment "Represents a TMHMM hit" . affx:Annotation a owl:Class ; owl:hasProperty affx:containsMotif; owl:hasProperty affx:commonToAll ; owl:hasProperty affx:motifCount . affx:containsMotif a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range affx:Motif ; owl:minCardinality "1" . affx:motifCount a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Number of motifs (eg. TM passes) in this annotation" . affx:Motif a owl:Class ; owl:hasProperty affx:hasProteinSpan . affx:hasProteinSpan a owl:ObjectProperty ; owl:domain affx:Motif ; owl:range affx:ProteinSpan . affx:ProteinCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Coordinates onto the protein sequence, possibly gapped ". affx:spannedBy a owl:ObjectProperty ; owl:domain affx:ProteinSpan ; owl:range affx:CdsSpan ; owl:minCardinality "1" . affx:ProteinSpan a owl:Class ; rdfs:subClassOf affx:ProteinCoordinates ; owl:hasProperty affx:spannedBy ; rdfs:comment "An ungapped region of the protein sequence " ; rdfs:comment "Each ProteinSpan as one or more corresponding CDS span" . affx:CdsSpan a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:inFrame ; rdfs:comment "A CDS span is a genomic span with a translation frame" ; rdfs:comment "Each CDS span describes a part of the full CDS region" . :Gene5365 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13879424] . :gi13879424 a affx:Transcript ; affx:unigene "iMm.196782" ; affx:translatesTo "MESNYETLVSLKVLGQPEEEVELGAEMVGDLVEEGTHLADRAMVKQEMLYKQEGPAGLPNMFSSAVEQQAFFGAEQAMFWNSPGDSALLESGPGDSNPESVETSRDPAPGRNLDCPRKQKSHRQVQLGQECGQGLKVKRDSSPYKCPECQISFRYKQQLTAHLQSHAGRESYSATEPEESLRPRPRLKPQAKRSKLHQCDVCHRSFSCKVSLVTHQRCHQQEGPSTSPQIQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCPECEKSFVQKQHLLQHQKIHQRERGGLASESARPNGLL" ; affx:hasCds [affx:startsAt "48254788" ; affx:stopsAt "48259243" ]; affx:hasExon [ affx:relatesToExon :Gene5365_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5365_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5365_e3; affx:cdsType "Partial" ; affx:cdsStart "48254788" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5365_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5365_e5; affx:cdsType "Partial" ; affx:cdsStop "48259243" ; affx:frame "1"] ; . :Gene5365_e1 a affx:Exon ; affx:startsAt "48248369" ; affx:stopsAt "48248424" ; affx:commonToAll "1" . :Gene5365_e2 a affx:Exon ; affx:startsAt "48254182" ; affx:stopsAt "48254572" ; affx:commonToAll "1" . :Gene5365_e3 a affx:Exon ; affx:startsAt "48254695" ; affx:stopsAt "48254822" ; affx:commonToAll "1" . :Gene5365_e4 a affx:Exon ; affx:startsAt "48256725" ; affx:stopsAt "48256806" ; affx:commonToAll "1" . :Gene5365_e5 a affx:Exon ; affx:startsAt "48258386" ; affx:stopsAt "48260315" ; affx:commonToAll "1" . :Gene5366 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18476094] . :gi18476094 a affx:Transcript ; affx:unigene "iMm.136079" ; affx:translatesTo "MPEAEMKEEAPEAHFTVDKQNISLWPREPPPKQDLSPVLRKPLCICVAFTCLALVLVTSIVLQAVFYPRLMGKILDVKSDAQMLKGRVDNISTLGSDLKTERGRVDDAEVQMQIVNTTLKRVRSQILSLETSMKIANDQLQILTMSWGEVDSLSAKIPELKRDLDKASALNTKVQGLQNSLENVNKLLKQQSDILEMVARGWKYFSGNFYYFSRTPKTWYSAEQFCISRKAHLTSVSSESEQKFLYKAADGIPHWIGLTKAGSEGDWYWVDQTSFNKEQSRRFWIPGEPNNAGNNEHCANIRVSALKCWNDGPCDNTFLFICKRPYVQTTE" ; affx:hasCds [affx:startsAt "84560717" ; affx:stopsAt "84566834" ]; affx:hasExon [ affx:relatesToExon :Gene5366_e1; affx:cdsType "Partial" ; affx:cdsStart "84560717" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5366_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5366_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5366_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5366_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5366_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "45" ; affx:stopsAt "67" ; affx:spannedBy [ affx:startsAt "84566543" ; affx:stopsAt "84566607" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "84564980" ; affx:stopsAt "84564982" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene5366_e1 a affx:Exon ; affx:startsAt "84560241" ; affx:stopsAt "84560868" ; affx:commonToAll "1" . :Gene5366_e2 a affx:Exon ; affx:startsAt "84561791" ; affx:stopsAt "84561910" ; affx:commonToAll "1" . :Gene5366_e3 a affx:Exon ; affx:startsAt "84563280" ; affx:stopsAt "84563432" ; affx:commonToAll "1" . :Gene5366_e4 a affx:Exon ; affx:startsAt "84564607" ; affx:stopsAt "84564982" ; affx:commonToAll "1" . :Gene5366_e5 a affx:Exon ; affx:startsAt "84566543" ; affx:stopsAt "84566660" ; affx:commonToAll "1" . :Gene5366_e6 a affx:Exon ; affx:startsAt "84566752" ; affx:stopsAt "84566834" ; affx:commonToAll "1" . :Gene5367 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi17046929] . :gi17046929 a affx:Transcript ; affx:unigene "iMm.21899" ; affx:translatesTo "MAPGSVSSVSSSSFPSRDTSPSGSCGLPGADKPGPSCRRIQAGQRNPTMLHMVLEALKAREARQGTSVVAIKVYIQHKYPTVDTTRFKYLLKQALETGVRRGLLTRPAHSKAKGATGSFKLVPKPKTKKACAPKAGRGAAGAKETGSKKSGLLKKDQVGKATMEKGQKRRAYPCKAATLEMAPKKAKAKPKEVRKAPLKQDKAAGAPLTANGGQKVKRSGSRQEANAHGKTKGEKSKPLASKVQNSVASLAKRKMADMAHTVTVVQGAETVQETKVPTPSQDIGHKVQPIPRVRKAKTPENTQA" ; affx:hasCds [affx:startsAt "116732269" ; affx:stopsAt "116737365" ]; affx:hasExon [ affx:relatesToExon :Gene5367_e1; affx:cdsType "Partial" ; affx:cdsStart "116732269" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5367_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5367_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5367_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5367_e5; affx:cdsType "Partial" ; affx:cdsStop "116737365" ; affx:frame "1"] ; . :Gene5367_e1 a affx:Exon ; affx:startsAt "116732225" ; affx:stopsAt "116732369" ; affx:commonToAll "1" . :Gene5367_e2 a affx:Exon ; affx:startsAt "116734921" ; affx:stopsAt "116735181" ; affx:commonToAll "1" . :Gene5367_e3 a affx:Exon ; affx:startsAt "116735890" ; affx:stopsAt "116736200" ; affx:commonToAll "1" . :Gene5367_e4 a affx:Exon ; affx:startsAt "116736972" ; affx:stopsAt "116737028" ; affx:commonToAll "1" . :Gene5367_e5 a affx:Exon ; affx:startsAt "116737176" ; affx:stopsAt "116737520" ; affx:commonToAll "1" . :Gene5368 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16973446] . :gi16973446 a affx:Transcript ; affx:unigene "iMm.20109" ; affx:translatesTo "MPTDMSMWTGPLSLHEVDEQPQHLLRVTYTEAEVEELGQVLTPTQVKHRPGSISWDGLDTGKLYTLILTDPDAPSRKKPVYREWHHFLVVNMKGNDISKGTGLHRYVWLVYQQDKPLRCDEPILTNRSGDHRGKFKTAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQLSGK" ; affx:hasCds [affx:startsAt "135652595" ; affx:stopsAt "135653159" ]; affx:hasExon [ affx:relatesToExon :Gene5368_e1; affx:cdsType "Partial" ; affx:cdsStart "135652595" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5368_e2; affx:cdsType "Partial" ; affx:cdsStop "135653159" ; affx:frame "0"] ; . :Gene5368_e1 a affx:Exon ; affx:startsAt "135651947" ; affx:stopsAt "135652822" ; affx:commonToAll "1" . :Gene5368_e2 a affx:Exon ; affx:startsAt "135652864" ; affx:stopsAt "135653175" ; affx:commonToAll "1" . :Gene5369 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi12659085] . :gi12659085 a affx:Transcript ; affx:unigene "iMm.24304" ; affx:translatesTo "MSAQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVSKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVVAEKQEKRNQERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHRSRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRHSSRDRSRERSKRRSSKERFRDQDLASRDRDRSSRDRSPRDRDRKDKKRSYESANGRSEDRRSSEEREAGEI" ; affx:hasCds [affx:startsAt "38744153" ; affx:stopsAt "38800706" ]; affx:hasExon [ affx:relatesToExon :Gene5369_e1; affx:cdsType "Partial" ; affx:cdsStart "38744153" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5369_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5369_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5369_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5369_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5369_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5369_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5369_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5369_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5369_e10; affx:cdsType "Partial" ; affx:cdsStop "38800706" ; affx:frame "1"] ; . :Gene5369_e1 a affx:Exon ; affx:startsAt "38743824" ; affx:stopsAt "38744214" ; affx:commonToAll "1" . :Gene5369_e2 a affx:Exon ; affx:startsAt "38762816" ; affx:stopsAt "38762911" ; affx:commonToAll "1" . :Gene5369_e3 a affx:Exon ; affx:startsAt "38777448" ; affx:stopsAt "38777547" ; affx:commonToAll "1" . :Gene5369_e4 a affx:Exon ; affx:startsAt "38781647" ; affx:stopsAt "38781758" ; affx:commonToAll "1" . :Gene5369_e5 a affx:Exon ; affx:startsAt "38783663" ; affx:stopsAt "38783807" ; affx:commonToAll "1" . :Gene5369_e6 a affx:Exon ; affx:startsAt "38784994" ; affx:stopsAt "38785171" ; affx:commonToAll "1" . :Gene5369_e7 a affx:Exon ; affx:startsAt "38785753" ; affx:stopsAt "38785845" ; affx:commonToAll "1" . :Gene5369_e8 a affx:Exon ; affx:startsAt "38791160" ; affx:stopsAt "38791190" ; affx:commonToAll "1" . :Gene5369_e9 a affx:Exon ; affx:startsAt "38795652" ; affx:stopsAt "38795844" ; affx:commonToAll "1" . :Gene5369_e10 a affx:Exon ; affx:startsAt "38800528" ; affx:stopsAt "38801821" ; affx:commonToAll "1" . :Gene5370 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi15451743] . :gi15451743 a affx:Transcript ; affx:unigene "iMm.157158" ; affx:translatesTo "MEIISLKRFILLTVATSSFLTSNTFCTDEFMMPHFHSKEGDGKYSQLRGIPKGEKERSVSFQELKDWGAKNVIKMSPAPANKVPHSAANLPLRFGRTIDEKRSPAARVNMEAGTRSHFPSLPQRFGRTTARSPKTPADLPQKPLHSLGSSELLYVMICQHQEIQSPGGKRTR" ; affx:hasCds [affx:startsAt "51028914" ; affx:stopsAt "51030818" ]; affx:hasExon [ affx:relatesToExon :Gene5370_e1; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5370_e2; affx:cdsType "Full" ; affx:frame "2"] ; . :Gene5370_e1 a affx:Exon ; affx:startsAt "51028914" ; affx:stopsAt "51029295" ; affx:commonToAll "1" . :Gene5370_e2 a affx:Exon ; affx:startsAt "51030680" ; affx:stopsAt "51030818" ; affx:commonToAll "1" . :Gene5371 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16741163] . :gi16741163 a affx:Transcript ; affx:unigene "iMm.44228" ; affx:translatesTo "MKKNRERFCNKEREFVYKFQVGRERLELRVPLRFPVEENASHLHGRLMLLHSLPCFIESDLKDALSRFIEEESLRDHDSDAEACLEAVKSGEVDLHQLASAWAKAYAETTLEHARPEEPDWDEDFADVYHDLIHSPASETLLNLEHNYFVSISELIGERDVELKKLRERQGIEMEKVMQELGKSLTDQDVNSLAAQHFESQQDLENKWSNELKQSTAIQKQEYQEWVIKLHQDLKNPNNSSLSEEIKVQPSQFRESADAAGRIYEEQRKLEESFTIHLGAQLKTMHNLRLLRADMLDFCKHKRTHGSGVKLHRLQTALSLYSTSLCGLVLLVDNRINSYSGIKRDFATVCQECTDFHFPRIEEQLEVVQQVALYARTQRKSKCKEARDSGNQNGGSDDKSKNAERNYLNILPGEFYITRHSNLSEIHVAFHLCVDDNVKSGNITARDPAIMGLRNILKVCCTHDITTISIPLLLVHDMSEEMTIPWCLRRAELVFKCVKGFMMEMASWDGGISRTVQFLVPQSISEEMFYQLSNMLPQIFRVSSTLTLTSKH" ; affx:hasCds [affx:startsAt "127839892" ; affx:stopsAt "127872427" ]; affx:hasExon [ affx:relatesToExon :Gene5371_e1; affx:cdsType "Partial" ; affx:cdsStart "127839892" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5371_e13; affx:cdsType "Partial" ; affx:cdsStop "127872427" ; affx:frame "0"] ; . :Gene5371_e1 a affx:Exon ; affx:startsAt "127839873" ; affx:stopsAt "127840070" ; affx:commonToAll "1" . :Gene5371_e2 a affx:Exon ; affx:startsAt "127842355" ; affx:stopsAt "127842501" ; affx:commonToAll "1" . :Gene5371_e3 a affx:Exon ; affx:startsAt "127844040" ; affx:stopsAt "127844222" ; affx:commonToAll "1" . :Gene5371_e4 a affx:Exon ; affx:startsAt "127847621" ; affx:stopsAt "127847721" ; affx:commonToAll "1" . :Gene5371_e5 a affx:Exon ; affx:startsAt "127847839" ; affx:stopsAt "127847961" ; affx:commonToAll "1" . :Gene5371_e6 a affx:Exon ; affx:startsAt "127852227" ; affx:stopsAt "127852334" ; affx:commonToAll "1" . :Gene5371_e7 a affx:Exon ; affx:startsAt "127852627" ; affx:stopsAt "127852825" ; affx:commonToAll "1" . :Gene5371_e8 a affx:Exon ; affx:startsAt "127853341" ; affx:stopsAt "127853470" ; affx:commonToAll "1" . :Gene5371_e9 a affx:Exon ; affx:startsAt "127859189" ; affx:stopsAt "127859264" ; affx:commonToAll "1" . :Gene5371_e10 a affx:Exon ; affx:startsAt "127864103" ; affx:stopsAt "127864306" ; affx:commonToAll "1" . :Gene5371_e11 a affx:Exon ; affx:startsAt "127870779" ; affx:stopsAt "127870837" ; affx:commonToAll "1" . :Gene5371_e12 a affx:Exon ; affx:startsAt "127871710" ; affx:stopsAt "127871778" ; affx:commonToAll "1" . :Gene5371_e13 a affx:Exon ; affx:startsAt "127872334" ; affx:stopsAt "127872844" ; affx:commonToAll "1" . :Gene5372 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi15929700] . :gi15929700 a affx:Transcript ; affx:unigene "iMm.213063" ; affx:translatesTo "MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVVSGVIG" ; affx:hasCds [affx:startsAt "48912340" ; affx:stopsAt "48912541" ]; affx:hasExon [ affx:relatesToExon :Gene5372_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5372_e2; affx:cdsType "Partial" ; affx:cdsStart "48912340" ; affx:cdsStop "48912541" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5372_e3; affx:cdsType "None" ] ; . :Gene5372_e1 a affx:Exon ; affx:startsAt "48909969" ; affx:stopsAt "48910079" ; affx:commonToAll "1" . :Gene5372_e2 a affx:Exon ; affx:startsAt "48910214" ; affx:stopsAt "48912564" ; affx:commonToAll "1" . :Gene5372_e3 a affx:Exon ; affx:startsAt "48912867" ; affx:stopsAt "48912920" ; affx:commonToAll "1" . :Gene5373 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi15928403] . :gi15928403 a affx:Transcript ; affx:unigene "iMm.170023" ; affx:translatesTo "MTAWILLPVSLSAFSITGIWTVYAMAVMNRHVCPVENWSYNESCSPDPAEQGGPKSCCTLDDVPLISKCGTYPPESCLFSLIGNMGAVMVALICLLRYGQLLEQSRHSWINTTALITGCTNAAGLVVVGNFQVDHAKSLHYIGTGVAFTDGLLFVCLHCVLFYHGATTPLDMAMAYLRSVLAVIAFITLVLSGVFFLHESSQLQHGAALCEWVFVLDILIFYGTFSYEFGTISSDTLVAALQPAPGRACKSSGSSSTSTHLNCAPESIAMI" ; affx:hasCds [affx:startsAt "73233121" ; affx:stopsAt "73236121" ]; affx:hasExon [ affx:relatesToExon :Gene5373_e1; affx:cdsType "Partial" ; affx:cdsStart "73233121" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5373_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5373_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5373_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5373_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5373_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5373_e7; affx:cdsType "Partial" ; affx:cdsStop "73236121" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "26" ; affx:spannedBy [ affx:startsAt "73233121" ; affx:stopsAt "73233186" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "73233595" ; affx:stopsAt "73233608" ; affx:inFrame "2" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "4" ; affx:containsMotif [ affx:startsAt "77" ; affx:stopsAt "96" ; affx:spannedBy [ affx:startsAt "73234853" ; affx:stopsAt "73234890" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "73235181" ; affx:stopsAt "73235201" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "109" ; affx:stopsAt "131" ; affx:spannedBy [ affx:startsAt "73235240" ; affx:stopsAt "73235306" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "141" ; affx:stopsAt "163" ; affx:spannedBy [ affx:startsAt "73235479" ; affx:stopsAt "73235545" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "208" ; affx:stopsAt "230" ; affx:spannedBy [ affx:startsAt "73235929" ; affx:stopsAt "73235995" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene5373_e1 a affx:Exon ; affx:startsAt "73233026" ; affx:stopsAt "73233186" ; affx:commonToAll "1" . :Gene5373_e2 a affx:Exon ; affx:startsAt "73233595" ; affx:stopsAt "73233643" ; affx:commonToAll "1" . :Gene5373_e3 a affx:Exon ; affx:startsAt "73233923" ; affx:stopsAt "73234010" ; affx:commonToAll "1" . :Gene5373_e4 a affx:Exon ; affx:startsAt "73234822" ; affx:stopsAt "73234890" ; affx:commonToAll "1" . :Gene5373_e5 a affx:Exon ; affx:startsAt "73235181" ; affx:stopsAt "73235309" ; affx:commonToAll "1" . :Gene5373_e6 a affx:Exon ; affx:startsAt "73235452" ; affx:stopsAt "73235630" ; affx:commonToAll "1" . :Gene5373_e7 a affx:Exon ; affx:startsAt "73235879" ; affx:stopsAt "73236632" ; affx:commonToAll "1" . :Gene5374 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16740614] . :gi16740614 a affx:Transcript ; affx:unigene "iMm.132482" ; affx:translatesTo "MAAEEALKTVDQYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDGLKQELEQLREAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLNKILEMQNELKQSRAVVTNVQAENERLSAVVQELKENNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYINLSDSHISISVDGLKFAEDGSEPNNDDKMNGHIHGPLGKLNGDYRTPTTRKGESLHPVSDLFSELNISEIQKLKQQLIQVEREKAILLANLQESQTQLEHTKGALTEQHERVHRLTEHVNAMRGLQNSKEIKAELDCEKGRNSAEEAHDYEVDKNGLEILECKYRVAVTEVIDLKAEIKALKEKYNKSVENYTEEKTKYESKIQMYDEQVTNLEKTSKESGEKMAHMEKELQKMTGIANENHNTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQSRVTRSGSLKGPDDPRGLLSPRLSRRGVSSPVESRTSSEPVSKENTETSKEPSPTKTPTISPVITAPPSSPVLDTSDIRKEPMNIYNLNAIIRDQIKHLQKAVDRSLQLSRQRAAARELAPMIDKDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQSRRSKGKLGKSKIGSPKIVSSLLPPYRHSAHN" ; affx:hasCds [affx:startsAt "150157584" ; affx:stopsAt "150298388" ]; affx:hasExon [ affx:relatesToExon :Gene5374_e1; affx:cdsType "Partial" ; affx:cdsStart "150157584" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5374_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5374_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5374_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5374_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5374_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5374_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5374_e8; affx:cdsType "Partial" ; affx:cdsStop "150298388" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5374_e9; affx:cdsType "None" ] ; . :Gene5374_e1 a affx:Exon ; affx:startsAt "150157436" ; affx:stopsAt "150157797" ; affx:commonToAll "1" . :Gene5374_e2 a affx:Exon ; affx:startsAt "150232250" ; affx:stopsAt "150232463" ; affx:commonToAll "1" . :Gene5374_e3 a affx:Exon ; affx:startsAt "150242827" ; affx:stopsAt "150242980" ; affx:commonToAll "1" . :Gene5374_e4 a affx:Exon ; affx:startsAt "150259531" ; affx:stopsAt "150259957" ; affx:commonToAll "1" . :Gene5374_e5 a affx:Exon ; affx:startsAt "150260635" ; affx:stopsAt "150261730" ; affx:commonToAll "1" . :Gene5374_e6 a affx:Exon ; affx:startsAt "150264772" ; affx:stopsAt "150264924" ; affx:commonToAll "1" . :Gene5374_e7 a affx:Exon ; affx:startsAt "150266745" ; affx:stopsAt "150266953" ; affx:commonToAll "1" . :Gene5374_e8 a affx:Exon ; affx:startsAt "150298340" ; affx:stopsAt "150298416" ; affx:commonToAll "1" . :Gene5374_e9 a affx:Exon ; affx:startsAt "150304634" ; affx:stopsAt "150304892" ; affx:commonToAll "1" . :Gene5375 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi15928434] . :gi15928434 a affx:Transcript ; affx:unigene "iMm.205854" ; affx:translatesTo "MKLPLSPSTEPVATEPLGMALLSSILAAWSYISENPERAALYFVSGVCIGLFLTLAALVMRISCHTDCRRGPRRRCLQDRECSDSSDSEDGSEDTASDLSVRRHRRFERTLNKNVFTSAEELERAQRLEERERIIREIWMNGQPEVPGTRSLNRYY" ; affx:hasCds [affx:startsAt "82957277" ; affx:stopsAt "82978283" ]; affx:hasExon [ affx:relatesToExon :Gene5375_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5375_e2; affx:cdsType "Partial" ; affx:cdsStart "82957277" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5375_e3; affx:cdsType "Partial" ; affx:cdsStop "82978283" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "38" ; affx:stopsAt "60" ; affx:spannedBy [ affx:startsAt "82977926" ; affx:stopsAt "82977992" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5375_e1 a affx:Exon ; affx:startsAt "82926854" ; affx:stopsAt "82927061" ; affx:commonToAll "1" . :Gene5375_e2 a affx:Exon ; affx:startsAt "82957189" ; affx:stopsAt "82957377" ; affx:commonToAll "1" . :Gene5375_e3 a affx:Exon ; affx:startsAt "82977912" ; affx:stopsAt "82979213" ; affx:commonToAll "1" . :Gene5376 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi15928450] . :gi15928450 a affx:Transcript ; affx:unigene "iMm.156814" ; affx:translatesTo "MAALAGLGVLGAGRHLWKLPVRLSAGLQGCGPRRGYIAGSAERSPTFGLLFDIDGVLVRGHRVIPAALEAFSKLVNSQGQLRVPVVFVTNAGNILQHNKAQELSDLLRCKVDPDQVILSHSPMKLFLQYHSKQMLVSGQGPLVENARALGFQNVVTIDELRLAFPELDMVDLQRRPKTMRLRSDFPAIEGVLLLGEPVRWETNLQLIMDVLLSNGHPGTGLATAPYPHLPVLASNMDLLWMAEAKMPRFGHGTFLLCLETIYRKITGNELKYEGLMGKPSILTYQYAEDVIRQQAERRGWAAPIRKLYAIGDNPMSDVYGANLFHQYLQMANRGEEEQQTGGQQKQRPSATQSCASILVCTGIYSSQDPGSQVPPPGRRELPFHGHRDFSFSPGLLEASHIVHDVNEAVQLVFHQEGWA" ; affx:hasCds [affx:startsAt "121309180" ; affx:stopsAt "121330338" ]; affx:hasExon [ affx:relatesToExon :Gene5376_e1; affx:cdsType "Partial" ; affx:cdsStart "121309180" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5376_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5376_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5376_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5376_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5376_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5376_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5376_e8; affx:cdsType "Partial" ; affx:cdsStop "121330338" ; affx:frame "2"] ; . :Gene5376_e1 a affx:Exon ; affx:startsAt "121308539" ; affx:stopsAt "121309508" ; affx:commonToAll "1" . :Gene5376_e2 a affx:Exon ; affx:startsAt "121309676" ; affx:stopsAt "121309865" ; affx:commonToAll "1" . :Gene5376_e3 a affx:Exon ; affx:startsAt "121313443" ; affx:stopsAt "121313618" ; affx:commonToAll "1" . :Gene5376_e4 a affx:Exon ; affx:startsAt "121316095" ; affx:stopsAt "121316126" ; affx:commonToAll "1" . :Gene5376_e5 a affx:Exon ; affx:startsAt "121317489" ; affx:stopsAt "121317583" ; affx:commonToAll "1" . :Gene5376_e6 a affx:Exon ; affx:startsAt "121320239" ; affx:stopsAt "121320352" ; affx:commonToAll "1" . :Gene5376_e7 a affx:Exon ; affx:startsAt "121322451" ; affx:stopsAt "121322655" ; affx:commonToAll "1" . :Gene5376_e8 a affx:Exon ; affx:startsAt "121330212" ; affx:stopsAt "121330345" ; affx:commonToAll "1" . :Tem8 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi15987504] . :gi15987504 a affx:Transcript ; affx:unigene "iMm.29636" ; affx:translatesTo "MDRAGRLGAGLRGLCVAALVLVCAGHGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLAHRFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENSQGYRTASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFAVEDTYLLCPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSDGSILAIALLVLFLLLALALLWWFWPLCCTVIIKEVPPPPVEESEEEDDDGLPKKKWPTVDASYYGGRGVGGIKRMEVRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRKWYSPIKGKLDALWVLLRKGYDRVSVMRPQPGDTGRCINFTRVKNSQPAKYPLNNTYHPSSPPPAPIYTPPPPAPHCPPPAPSAPTPPIPSPPSTLPPPPQGPPPNRAPPPSRPPPRPSV" ; affx:hasCds [affx:startsAt "87994884" ; affx:stopsAt "88191074" ]; affx:hasExon [ affx:relatesToExon :Tem8_e1; affx:cdsType "Partial" ; affx:cdsStart "87994884" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tem8_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tem8_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tem8_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tem8_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tem8_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tem8_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tem8_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tem8_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tem8_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tem8_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tem8_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tem8_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tem8_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tem8_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tem8_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tem8_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tem8_e18; affx:cdsType "Partial" ; affx:cdsStop "88191074" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "30" ; affx:spannedBy [ affx:startsAt "88190984" ; affx:stopsAt "88191074" ; affx:inFrame "1" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "319" ; affx:stopsAt "341" ; affx:spannedBy [ affx:startsAt "88074428" ; affx:stopsAt "88074494" ; affx:inFrame "2" ] ; ] ; ] ; . :Tem8_e1 a affx:Exon ; affx:startsAt "87991642" ; affx:stopsAt "87995145" ; affx:commonToAll "1" . :Tem8_e2 a affx:Exon ; affx:startsAt "88037652" ; affx:stopsAt "88037733" ; affx:commonToAll "1" . :Tem8_e3 a affx:Exon ; affx:startsAt "88045218" ; affx:stopsAt "88045386" ; affx:commonToAll "1" . :Tem8_e4 a affx:Exon ; affx:startsAt "88045847" ; affx:stopsAt "88045943" ; affx:commonToAll "1" . :Tem8_e5 a affx:Exon ; affx:startsAt "88061545" ; affx:stopsAt "88061587" ; affx:commonToAll "1" . :Tem8_e6 a affx:Exon ; affx:startsAt "88074410" ; affx:stopsAt "88074506" ; affx:commonToAll "1" . :Tem8_e7 a affx:Exon ; affx:startsAt "88097211" ; affx:stopsAt "88097290" ; affx:commonToAll "1" . :Tem8_e8 a affx:Exon ; affx:startsAt "88098748" ; affx:stopsAt "88098818" ; affx:commonToAll "1" . :Tem8_e9 a affx:Exon ; affx:startsAt "88112174" ; affx:stopsAt "88112273" ; affx:commonToAll "1" . :Tem8_e10 a affx:Exon ; affx:startsAt "88125634" ; affx:stopsAt "88125695" ; affx:commonToAll "1" . :Tem8_e11 a affx:Exon ; affx:startsAt "88139078" ; affx:stopsAt "88139159" ; affx:commonToAll "1" . :Tem8_e12 a affx:Exon ; affx:startsAt "88140645" ; affx:stopsAt "88140714" ; affx:commonToAll "1" . :Tem8_e13 a affx:Exon ; affx:startsAt "88143392" ; affx:stopsAt "88143472" ; affx:commonToAll "1" . :Tem8_e14 a affx:Exon ; affx:startsAt "88144543" ; affx:stopsAt "88144577" ; affx:commonToAll "1" . :Tem8_e15 a affx:Exon ; affx:startsAt "88145149" ; affx:stopsAt "88145231" ; affx:commonToAll "1" . :Tem8_e16 a affx:Exon ; affx:startsAt "88164355" ; affx:stopsAt "88164427" ; affx:commonToAll "1" . :Tem8_e17 a affx:Exon ; affx:startsAt "88168351" ; affx:stopsAt "88168423" ; affx:commonToAll "1" . :Tem8_e18 a affx:Exon ; affx:startsAt "88190928" ; affx:stopsAt "88191347" ; affx:commonToAll "1" . :Gig18 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi14150746] . :gi14150746 a affx:Transcript ; affx:unigene "iMm.27320" ; affx:translatesTo "MCPSPWPHMCWRHRAPSATFLTTYSHTMSATTCPDSVDRPKSQHIRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMRDKATQTPSCWAEEGAEKRSHQRSASWGSADQLKEIAKLRQQLQRSKQSSRHSKEKDRQSPLHGNHITISHTQAIGSRSVPMPLSNISVPKSSVSRVPCNVEGISPELEKVFIKENNGKEEVSKPLDIPDGRRAPLPAHYRSSSTRSIDTQTPSVQERSSSCSSHSPCVSPFCPPESQDGSPCSTEDLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKREPPEGCERVKVFEEMASRQPISAPLFSCPDKNKVNFIPTGSAFCPVKLLGPLLPASDLMLKNSPNSGQSSALATLTVEQLSSRVSFTSLSDDTSTADSLEPSAQQPSQQQQLLQDLQVEEHVSTQNYVMI" ; affx:hasCds [affx:startsAt "8180703" ; affx:stopsAt "8347598" ]; affx:hasExon [ affx:relatesToExon :Gig18_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gig18_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gig18_e3; affx:cdsType "Partial" ; affx:cdsStart "8180703" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gig18_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gig18_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gig18_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gig18_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gig18_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gig18_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gig18_e10; affx:cdsType "Partial" ; affx:cdsStop "8347598" ; affx:frame "2"] ; . :Gig18_e1 a affx:Exon ; affx:startsAt "8024047" ; affx:stopsAt "8024160" ; affx:commonToAll "1" . :Gig18_e2 a affx:Exon ; affx:startsAt "8127224" ; affx:stopsAt "8127286" ; affx:commonToAll "1" . :Gig18_e3 a affx:Exon ; affx:startsAt "8180597" ; affx:stopsAt "8180812" ; affx:commonToAll "1" . :Gig18_e4 a affx:Exon ; affx:startsAt "8291640" ; affx:stopsAt "8291792" ; affx:commonToAll "1" . :Gig18_e5 a affx:Exon ; affx:startsAt "8312512" ; affx:stopsAt "8312599" ; affx:commonToAll "1" . :Gig18_e6 a affx:Exon ; affx:startsAt "8327290" ; affx:stopsAt "8327404" ; affx:commonToAll "1" . :Gig18_e7 a affx:Exon ; affx:startsAt "8333811" ; affx:stopsAt "8333964" ; affx:commonToAll "1" . :Gig18_e8 a affx:Exon ; affx:startsAt "8336826" ; affx:stopsAt "8337037" ; affx:commonToAll "1" . :Gig18_e9 a affx:Exon ; affx:startsAt "8345890" ; affx:stopsAt "8346011" ; affx:commonToAll "1" . :Gig18_e10 a affx:Exon ; affx:startsAt "8347252" ; affx:stopsAt "8351826" ; affx:commonToAll "1" . :Gene5379 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi14586771] . :gi14586771 a affx:Transcript ; affx:unigene "iMm.197689" ; affx:translatesTo "MLQRADLTAADCLQEGEMGKKIQGKCFRIISTVSPVKLYCCYGVIMVLTVAVIALSVALSVRNKIPAMEDREPCYTACPSGWIGFGSKCFYFSEDMGNWTFSQSSCVASNSHLALFHSLEELNFLKRYKGTSDHWIGLHRASTQHPWIWTDNTEYSNLVLTRGGGECGFLSDNGISSGRSYTHRKWICSKFVSSCKSRVGSVPRHV" ; affx:hasCds [affx:startsAt "129582966" ; affx:stopsAt "129596420" ]; affx:hasExon [ affx:relatesToExon :Gene5379_e1; affx:cdsType "Partial" ; affx:cdsStart "129582966" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5379_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5379_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5379_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5379_e5; affx:cdsType "Partial" ; affx:cdsStop "129596420" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "38" ; affx:stopsAt "60" ; affx:spannedBy [ affx:startsAt "129591331" ; affx:stopsAt "129591397" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5379_e1 a affx:Exon ; affx:startsAt "129582894" ; affx:stopsAt "129583021" ; affx:commonToAll "1" . :Gene5379_e2 a affx:Exon ; affx:startsAt "129591272" ; affx:stopsAt "129591398" ; affx:commonToAll "1" . :Gene5379_e3 a affx:Exon ; affx:startsAt "129594467" ; affx:stopsAt "129594652" ; affx:commonToAll "1" . :Gene5379_e4 a affx:Exon ; affx:startsAt "129595223" ; affx:stopsAt "129595330" ; affx:commonToAll "1" . :Gene5379_e5 a affx:Exon ; affx:startsAt "129596272" ; affx:stopsAt "129596524" ; affx:commonToAll "1" . :Gene5380 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13277633] . :gi13277633 a affx:Transcript ; affx:unigene "iMm.2408" ; affx:translatesTo "MESCPADTNSTDLHSRPLFQPQDIASMVILGLTCLLGLLGNGLVLWVAGVKMKTTVNTVWFLHLTLADFLCCLSLPFSLAHLILQGHWPYGLFLCKLIPSIIILNMFASVFLLTAISLDRCLIVHKPIWCQNHRNVRTAFAICGCVWVVAFVMCVPVFVYRDLFIMDNRSICRYNFDSSRSYDYWDYVYKLSLPESNSTDNSTAQLTGHMNDRSAPSSVQARDYFWTVTTALQSQPFLTSPEDSFSLDSANQQPHYGGKPPNVLTAAVPSGFPVEDRKSNTLNADAFLSAHTELFPTASSGHLYPYDFQGDYVDQFTYDNHVPTPLMAITITRLVVGFLVPFFIMVICYSLIVFRMRKTNFTKSRNKTFRVAVAVVTVFFICWTPYHLVGVLLLITDPESSLGEAVMSWDHMSIALASANSCFNPFLYALLGKDFRKKARQSIKGILEAAFSEELTHSTNCTQDKASSKRNNMSTDV" ; affx:hasCds [affx:startsAt "123903149" ; affx:stopsAt "123904583" ]; affx:hasExon [ affx:relatesToExon :Gene5380_e1; affx:cdsType "Partial" ; affx:cdsStart "123903149" ; affx:cdsStop "123904583" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5380_e2; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "24" ; affx:stopsAt "46" ; affx:spannedBy [ affx:startsAt "123904445" ; affx:stopsAt "123904511" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "59" ; affx:stopsAt "81" ; affx:spannedBy [ affx:startsAt "123904340" ; affx:stopsAt "123904406" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "96" ; affx:stopsAt "118" ; affx:spannedBy [ affx:startsAt "123904229" ; affx:stopsAt "123904295" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "138" ; affx:stopsAt "160" ; affx:spannedBy [ affx:startsAt "123904103" ; affx:stopsAt "123904169" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "331" ; affx:stopsAt "353" ; affx:spannedBy [ affx:startsAt "123903524" ; affx:stopsAt "123903590" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "373" ; affx:stopsAt "395" ; affx:spannedBy [ affx:startsAt "123903398" ; affx:stopsAt "123903464" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "410" ; affx:stopsAt "432" ; affx:spannedBy [ affx:startsAt "123903287" ; affx:stopsAt "123903353" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene5380_e1 a affx:Exon ; affx:startsAt "123902991" ; affx:stopsAt "123904591" ; affx:commonToAll "1" . :Gene5380_e2 a affx:Exon ; affx:startsAt "123909383" ; affx:stopsAt "123909470" ; affx:commonToAll "1" . :Gene5381 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13097341] . :gi13097341 a affx:Transcript ; affx:unigene "iMm.195869" ; affx:translatesTo "MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD" ; affx:hasCds [affx:startsAt "121600077" ; affx:stopsAt "121627017" ]; affx:hasExon [ affx:relatesToExon :Gene5381_e1; affx:cdsType "Partial" ; affx:cdsStart "121600077" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5381_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5381_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5381_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5381_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5381_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5381_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5381_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5381_e9; affx:cdsType "Partial" ; affx:cdsStop "121627017" ; affx:frame "2"] ; . :Gene5381_e1 a affx:Exon ; affx:startsAt "121599619" ; affx:stopsAt "121600140" ; affx:commonToAll "1" . :Gene5381_e2 a affx:Exon ; affx:startsAt "121602252" ; affx:stopsAt "121602340" ; affx:commonToAll "1" . :Gene5381_e3 a affx:Exon ; affx:startsAt "121605418" ; affx:stopsAt "121605513" ; affx:commonToAll "1" . :Gene5381_e4 a affx:Exon ; affx:startsAt "121607683" ; affx:stopsAt "121607752" ; affx:commonToAll "1" . :Gene5381_e5 a affx:Exon ; affx:startsAt "121608418" ; affx:stopsAt "121608508" ; affx:commonToAll "1" . :Gene5381_e6 a affx:Exon ; affx:startsAt "121611960" ; affx:stopsAt "121612027" ; affx:commonToAll "1" . :Gene5381_e7 a affx:Exon ; affx:startsAt "121612736" ; affx:stopsAt "121612846" ; affx:commonToAll "1" . :Gene5381_e8 a affx:Exon ; affx:startsAt "121622730" ; affx:stopsAt "121622796" ; affx:commonToAll "1" . :Gene5381_e9 a affx:Exon ; affx:startsAt "121626984" ; affx:stopsAt "121627082" ; affx:commonToAll "1" . :Gene5382 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13097428] . :gi13097428 a affx:Transcript ; affx:unigene "iMm.29815" ; affx:translatesTo "MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAIDYQKVVREAIKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGVHLDRNEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDSKTQVTVQYMQDRGAVLPIRVHTIVISVQHDEEVCLDEMRDALKEKVIKAVVPAKYLDEDTIYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARWVAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKY" ; affx:hasCds [affx:startsAt "73310919" ; affx:stopsAt "73316063" ]; affx:hasExon [ affx:relatesToExon :Gene5382_e1; affx:cdsType "Partial" ; affx:cdsStart "73310919" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5382_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5382_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5382_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5382_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5382_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5382_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5382_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5382_e9; affx:cdsType "Partial" ; affx:cdsStop "73316063" ; affx:frame "0"] ; . :Gene5382_e1 a affx:Exon ; affx:startsAt "73310310" ; affx:stopsAt "73311022" ; affx:commonToAll "1" . :Gene5382_e2 a affx:Exon ; affx:startsAt "73311607" ; affx:stopsAt "73311741" ; affx:commonToAll "1" . :Gene5382_e3 a affx:Exon ; affx:startsAt "73311832" ; affx:stopsAt "73312015" ; affx:commonToAll "1" . :Gene5382_e4 a affx:Exon ; affx:startsAt "73312437" ; affx:stopsAt "73312656" ; affx:commonToAll "1" . :Gene5382_e5 a affx:Exon ; affx:startsAt "73312823" ; affx:stopsAt "73312967" ; affx:commonToAll "1" . :Gene5382_e6 a affx:Exon ; affx:startsAt "73313043" ; affx:stopsAt "73313156" ; affx:commonToAll "1" . :Gene5382_e7 a affx:Exon ; affx:startsAt "73313621" ; affx:stopsAt "73313744" ; affx:commonToAll "1" . :Gene5382_e8 a affx:Exon ; affx:startsAt "73313997" ; affx:stopsAt "73314075" ; affx:commonToAll "1" . :Gene5382_e9 a affx:Exon ; affx:startsAt "73315972" ; affx:stopsAt "73316125" ; affx:commonToAll "1" . :Nobox a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16923258] . :gi16923258 a affx:Transcript ; affx:unigene "iMm.17715" ; affx:translatesTo "MEPTEKLCKKMQGQEAGDKPRTAALETEGPLQDSALPIQDDQDKQSSLPRASLGKRPLSKTSEELMDAGTCRVHKAPTAAACGPQSEEEGCSPPERKAESLKPSISAVPGQATAGSLNSHEGDLKKESLEVTCQFRKKTRTLYRSDQLEELERIFQEDHYPDSDKRHEISQMVGVTPQRIMVWFQNRRAKWRKVEKLNEKETKNGPAAPSADSSQHRSAPELLDPMPTDLEPGPVPPENILDVFPEPPMLLTSEQTLTPFQNNEGAERVAVTPPLLSPPPIRRANLPLPLGPVQTPQVLPPMRDVPGSDSIYKDKAYVSWGTSIASPPTYSNLEDLGSQDYQASSQLGSFQLSQAPHLPLFPSLQSQFPYLPPFPYPIPSSMPFLPPEDSLFSFPFGFSGDSSQDYCPGPPPGQILLQPPAENMGTGPWSGHCLPEPPFPRPHYPQALGQPLGAEGYFPNLLPTPYALTMSKQSSLGLNGLLEGTRVETGSSLSKMSDEQTSSSLEQPALEEVRDKNKNSHAAGAKE" ; affx:hasCds [affx:startsAt "43524696" ; affx:stopsAt "43530268" ]; affx:hasExon [ affx:relatesToExon :Nobox_e1; affx:cdsType "Partial" ; affx:cdsStart "43524696" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Nobox_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Nobox_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Nobox_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Nobox_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Nobox_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Nobox_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Nobox_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Nobox_e9; affx:cdsType "Partial" ; affx:cdsStop "43530268" ; affx:frame "0"] ; . :Nobox_e1 a affx:Exon ; affx:startsAt "43524415" ; affx:stopsAt "43525007" ; affx:commonToAll "1" . :Nobox_e2 a affx:Exon ; affx:startsAt "43525606" ; affx:stopsAt "43525911" ; affx:commonToAll "1" . :Nobox_e3 a affx:Exon ; affx:startsAt "43526245" ; affx:stopsAt "43526477" ; affx:commonToAll "1" . :Nobox_e4 a affx:Exon ; affx:startsAt "43526705" ; affx:stopsAt "43526791" ; affx:commonToAll "1" . :Nobox_e5 a affx:Exon ; affx:startsAt "43527044" ; affx:stopsAt "43527151" ; affx:commonToAll "1" . :Nobox_e6 a affx:Exon ; affx:startsAt "43527456" ; affx:stopsAt "43527563" ; affx:commonToAll "1" . :Nobox_e7 a affx:Exon ; affx:startsAt "43527916" ; affx:stopsAt "43528024" ; affx:commonToAll "1" . :Nobox_e8 a affx:Exon ; affx:startsAt "43528124" ; affx:stopsAt "43528415" ; affx:commonToAll "1" . :Nobox_e9 a affx:Exon ; affx:startsAt "43530231" ; affx:stopsAt "43530296" ; affx:commonToAll "1" . :Gene5384 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi17390777] . :gi17390777 a affx:Transcript ; affx:unigene "iMm.77361" ; affx:translatesTo "MNLSAAHHQISLSDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEGKVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFKPGKEIYPRDENGRIIYDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQTKLLKFCQQHDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGIVVIPKSFTPERIKENFQIFDFSLTEEEMKDIDALNKNVRYVELLMWSDHPEYPFHDEY" ; affx:hasCds [affx:startsAt "37721966" ; affx:stopsAt "37758911" ]; affx:hasExon [ affx:relatesToExon :Gene5384_e1; affx:cdsType "Partial" ; affx:cdsStart "37721966" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5384_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5384_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5384_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5384_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5384_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5384_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5384_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5384_e9; affx:cdsType "Partial" ; affx:cdsStop "37758911" ; affx:frame "0"] ; . :Gene5384_e1 a affx:Exon ; affx:startsAt "37721894" ; affx:stopsAt "37722059" ; affx:commonToAll "1" . :Gene5384_e2 a affx:Exon ; affx:startsAt "37724203" ; affx:stopsAt "37724368" ; affx:commonToAll "1" . :Gene5384_e3 a affx:Exon ; affx:startsAt "37727665" ; affx:stopsAt "37727782" ; affx:commonToAll "1" . :Gene5384_e4 a affx:Exon ; affx:startsAt "37741950" ; affx:stopsAt "37742028" ; affx:commonToAll "1" . :Gene5384_e5 a affx:Exon ; affx:startsAt "37746226" ; affx:stopsAt "37746349" ; affx:commonToAll "1" . :Gene5384_e6 a affx:Exon ; affx:startsAt "37749233" ; affx:stopsAt "37749343" ; affx:commonToAll "1" . :Gene5384_e7 a affx:Exon ; affx:startsAt "37750113" ; affx:stopsAt "37750279" ; affx:commonToAll "1" . :Gene5384_e8 a affx:Exon ; affx:startsAt "37756166" ; affx:stopsAt "37756249" ; affx:commonToAll "1" . :Gene5384_e9 a affx:Exon ; affx:startsAt "37758868" ; affx:stopsAt "37760140" ; affx:commonToAll "1" . :Gene5385 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi17512304] . :gi17512304 a affx:Transcript ; affx:unigene "iMm.200426" ; affx:translatesTo "MAKVAKDLNPGVQKMSLGQQQSARGVACLRCKGMCSGFEPHSWRKICKSCKCSQEEHCLSSDLDDDRKIGRLLMDSKYATLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKERQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLVENELKAMEEFVKHYKSEALGVGEVALPGQGGLPKEENKTQEKPEGTETTAPTTNGSLGDPSKEVEYVCELCKGAAPVDSPVVYADRAGYSKQWHPTCFQCIKCSEPLVDLIYFWKDGAPWCGRHYCESVRPRCSGCDEIIFSEDYQRVEDLAWHRKHFICEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS" ; affx:hasCds [affx:startsAt "113175647" ; affx:stopsAt "113232725" ]; affx:hasExon [ affx:relatesToExon :Gene5385_e1; affx:cdsType "Partial" ; affx:cdsStart "113175647" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5385_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5385_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5385_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5385_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5385_e6; affx:cdsType "Partial" ; affx:cdsStop "113232725" ; affx:frame "2"] ; . :Gene5385_e1 a affx:Exon ; affx:startsAt "113175534" ; affx:stopsAt "113175689" ; affx:commonToAll "1" . :Gene5385_e2 a affx:Exon ; affx:startsAt "113207806" ; affx:stopsAt "113207895" ; affx:commonToAll "1" . :Gene5385_e3 a affx:Exon ; affx:startsAt "113213243" ; affx:stopsAt "113213499" ; affx:commonToAll "1" . :Gene5385_e4 a affx:Exon ; affx:startsAt "113218333" ; affx:stopsAt "113218669" ; affx:commonToAll "1" . :Gene5385_e5 a affx:Exon ; affx:startsAt "113231421" ; affx:stopsAt "113231637" ; affx:commonToAll "1" . :Gene5385_e6 a affx:Exon ; affx:startsAt "113232566" ; affx:stopsAt "113233184" ; affx:commonToAll "1" . :Gene5386 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi17391285] . :gi17391285 a affx:Transcript ; affx:unigene "iMm.214957" ; affx:translatesTo "MVIYVTLALWPQITQKKANGNFFWYLGLLLKLGLLLLCIWFLAYSQGAFEKIFSLWPLSKCFELEGSVYEWWFRWRLDRYVVFHGVLFAFIYLALQRRQILSEGKGEPLFSNKISNFLLFVSVVSFLTYSIWASSCKNKAECNELHPSVSVVQIVAFILIRNIPGYARSIYSSFFAWFGKISLELFICQYHIWLAADTRGILVLIPGNPTLNIIVSTFIFVCVAHEISQITTDLAQVVIPKDNPSLFRRLACTIAFFGGVLILSSIQDKSRL" ; affx:hasCds [affx:startsAt "4336549" ; affx:stopsAt "4347732" ]; affx:hasExon [ affx:relatesToExon :Gene5386_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5386_e2; affx:cdsType "Partial" ; affx:cdsStart "4336549" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5386_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5386_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5386_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5386_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5386_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5386_e8; affx:cdsType "Partial" ; affx:cdsStop "4347732" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "45" ; affx:spannedBy [ affx:startsAt "4336549" ; affx:stopsAt "4336607" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "4336961" ; affx:stopsAt "4337038" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "6" ; affx:containsMotif [ affx:startsAt "80" ; affx:stopsAt "95" ; affx:spannedBy [ affx:startsAt "4341188" ; affx:stopsAt "4341233" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "116" ; affx:stopsAt "133" ; affx:spannedBy [ affx:startsAt "4341296" ; affx:stopsAt "4341329" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "4342582" ; affx:stopsAt "4342600" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "148" ; affx:stopsAt "165" ; affx:spannedBy [ affx:startsAt "4342645" ; affx:stopsAt "4342660" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "4346528" ; affx:stopsAt "4346564" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "170" ; affx:stopsAt "192" ; affx:spannedBy [ affx:startsAt "4346579" ; affx:stopsAt "4346621" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "4347465" ; affx:stopsAt "4347489" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "202" ; affx:stopsAt "224" ; affx:spannedBy [ affx:startsAt "4347519" ; affx:stopsAt "4347585" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "245" ; affx:stopsAt "267" ; affx:spannedBy [ affx:startsAt "4347648" ; affx:stopsAt "4347714" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5386_e1 a affx:Exon ; affx:startsAt "4335442" ; affx:stopsAt "4335524" ; affx:commonToAll "1" . :Gene5386_e2 a affx:Exon ; affx:startsAt "4336450" ; affx:stopsAt "4336607" ; affx:commonToAll "1" . :Gene5386_e3 a affx:Exon ; affx:startsAt "4336961" ; affx:stopsAt "4337041" ; affx:commonToAll "1" . :Gene5386_e4 a affx:Exon ; affx:startsAt "4339444" ; affx:stopsAt "4339546" ; affx:commonToAll "1" . :Gene5386_e5 a affx:Exon ; affx:startsAt "4341188" ; affx:stopsAt "4341329" ; affx:commonToAll "1" . :Gene5386_e6 a affx:Exon ; affx:startsAt "4342582" ; affx:stopsAt "4342660" ; affx:commonToAll "1" . :Gene5386_e7 a affx:Exon ; affx:startsAt "4346528" ; affx:stopsAt "4346621" ; affx:commonToAll "1" . :Gene5386_e8 a affx:Exon ; affx:startsAt "4347465" ; affx:stopsAt "4348598" ; affx:commonToAll "1" . :Gene5387 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16741405] . :gi16741405 a affx:Transcript ; affx:unigene "iMm.1196" ; affx:translatesTo "MYCSAECRLAAAEQYHQILCPGPSHDPRHPLNKLQEAWRSVHYPPETASIMLMARMVATVKQAKDKDHWVRLFNHFCSRTANQEQAIVHKLLKGKFKDQLELLLGLFKEALYEEALSLWFTPEGFRSLFALVGTNGQGIGTSSLSQWVHACDALELTPQDREQLDTFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFVLHVTALEDIKPGEEICISYLDCCQRERSRHSRHKILRENYLFNCSCPKCLAEADDPNVTSEEEEEEDEEEGEPEDAELGDEMTDV" ; affx:hasCds [affx:startsAt "86341648" ; affx:stopsAt "86347205" ]; affx:hasExon [ affx:relatesToExon :Gene5387_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5387_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5387_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5387_e4; affx:cdsType "Partial" ; affx:cdsStart "86341648" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5387_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5387_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5387_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5387_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5387_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5387_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5387_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5387_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5387_e13; affx:cdsType "Partial" ; affx:cdsStop "86347205" ; affx:frame "1"] ; . :Gene5387_e1 a affx:Exon ; affx:startsAt "86333977" ; affx:stopsAt "86334089" ; affx:commonToAll "1" . :Gene5387_e2 a affx:Exon ; affx:startsAt "86340096" ; affx:stopsAt "86340205" ; affx:commonToAll "1" . :Gene5387_e3 a affx:Exon ; affx:startsAt "86340738" ; affx:stopsAt "86340878" ; affx:commonToAll "1" . :Gene5387_e4 a affx:Exon ; affx:startsAt "86341645" ; affx:stopsAt "86341764" ; affx:commonToAll "1" . :Gene5387_e5 a affx:Exon ; affx:startsAt "86342094" ; affx:stopsAt "86342164" ; affx:commonToAll "1" . :Gene5387_e6 a affx:Exon ; affx:startsAt "86342628" ; affx:stopsAt "86342733" ; affx:commonToAll "1" . :Gene5387_e7 a affx:Exon ; affx:startsAt "86343548" ; affx:stopsAt "86343611" ; affx:commonToAll "1" . :Gene5387_e8 a affx:Exon ; affx:startsAt "86343726" ; affx:stopsAt "86343797" ; affx:commonToAll "1" . :Gene5387_e9 a affx:Exon ; affx:startsAt "86344099" ; affx:stopsAt "86344206" ; affx:commonToAll "1" . :Gene5387_e10 a affx:Exon ; affx:startsAt "86344587" ; affx:stopsAt "86344644" ; affx:commonToAll "1" . :Gene5387_e11 a affx:Exon ; affx:startsAt "86346231" ; affx:stopsAt "86346326" ; affx:commonToAll "1" . :Gene5387_e12 a affx:Exon ; affx:startsAt "86346906" ; affx:stopsAt "86346977" ; affx:commonToAll "1" . :Gene5387_e13 a affx:Exon ; affx:startsAt "86347057" ; affx:stopsAt "86347772" ; affx:commonToAll "1" . :Gene5388 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi17512350] . :gi17512350 a affx:Transcript ; affx:unigene "iMm.34744" ; affx:translatesTo "MKSDASTSAAPLKGLVGPLRSSEPALALPAVSPAVHLLEEASDLLVVHLDFHAALETCERAWQSLAEEPVSGTIVEVKCSLCVVGIQALAEMDRWREALSWVLRYYQVPEKLPPKVLELCILLYSKMKEPGAVLDVASAWLQDPDNQGLPDYGSLARLHVFRLLLPSGRLSEAEELAVRSAAFSEEQRVEALQAIHLARQQHTQEHTQEHSDSQEPQKLRQEGSFSQKLLSLLMLLRRLWGSVVSHLLSQPFRKGLLAALILCLLILRFDPAAPSSLPFLYQLTQLFRRIQKATLSRLYPLALRD" ; affx:hasCds [affx:startsAt "121989138" ; affx:stopsAt "121998490" ]; affx:hasExon [ affx:relatesToExon :Gene5388_e1; affx:cdsType "Partial" ; affx:cdsStart "121989138" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5388_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5388_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5388_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5388_e5; affx:cdsType "Partial" ; affx:cdsStop "121998490" ; affx:frame "0"] ; . :Gene5388_e1 a affx:Exon ; affx:startsAt "121988788" ; affx:stopsAt "121989356" ; affx:commonToAll "1" . :Gene5388_e2 a affx:Exon ; affx:startsAt "121990583" ; affx:stopsAt "121990724" ; affx:commonToAll "1" . :Gene5388_e3 a affx:Exon ; affx:startsAt "121992132" ; affx:stopsAt "121992440" ; affx:commonToAll "1" . :Gene5388_e4 a affx:Exon ; affx:startsAt "121994975" ; affx:stopsAt "121995122" ; affx:commonToAll "1" . :Gene5388_e5 a affx:Exon ; affx:startsAt "121998386" ; affx:stopsAt "122000980" ; affx:commonToAll "1" . :Gene5389 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi17390829] . :gi17390829 a affx:Transcript ; affx:unigene "iMm.23809" ; affx:translatesTo "MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPPPPGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVMDDDESDEKEANSS" ; affx:hasCds [affx:startsAt "87872945" ; affx:stopsAt "87885768" ]; affx:hasExon [ affx:relatesToExon :Gene5389_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5389_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5389_e3; affx:cdsType "Partial" ; affx:cdsStart "87872945" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5389_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5389_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5389_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5389_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5389_e8; affx:cdsType "Partial" ; affx:cdsStop "87885768" ; affx:frame "2"] ; . :Gene5389_e1 a affx:Exon ; affx:startsAt "87867286" ; affx:stopsAt "87867331" ; affx:commonToAll "1" . :Gene5389_e2 a affx:Exon ; affx:startsAt "87870278" ; affx:stopsAt "87870379" ; affx:commonToAll "1" . :Gene5389_e3 a affx:Exon ; affx:startsAt "87872937" ; affx:stopsAt "87873073" ; affx:commonToAll "1" . :Gene5389_e4 a affx:Exon ; affx:startsAt "87876737" ; affx:stopsAt "87876804" ; affx:commonToAll "1" . :Gene5389_e5 a affx:Exon ; affx:startsAt "87878091" ; affx:stopsAt "87878212" ; affx:commonToAll "1" . :Gene5389_e6 a affx:Exon ; affx:startsAt "87880500" ; affx:stopsAt "87880561" ; affx:commonToAll "1" . :Gene5389_e7 a affx:Exon ; affx:startsAt "87882911" ; affx:stopsAt "87883086" ; affx:commonToAll "1" . :Gene5389_e8 a affx:Exon ; affx:startsAt "87885720" ; affx:stopsAt "87885885" ; affx:commonToAll "1" . :Gene5390 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi17390693] . :gi17390693 a affx:Transcript ; affx:unigene "iMm.197816" ; affx:translatesTo "MARCRGRFVCPVILFKGKHICRSATLAGWGELYGRSGYNYLFSGGADDTWASTEDVTEEDFVLRSGDTHLFDKVRGYDIKLLQYLSVKYICDLMVENKKVKFGMNVTSSEKVDKAQRYANFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLNIPNFLTQSLNIDWSQYQSWDLVQQTQNYLKLLLFIMNRDDDSGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLKPAEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFCLKTQRRKSLPTRDAGFTVEDICMLRHKDRGSTTSLGSDFSLVLEHSPGAVGSFSYETVELAPAGAPTQAAWRKSHSSSPQSMLWSRPQPSEERLPSHHGLTEAKSSSSSSSNHSDNFFRMGSSPLEVPKPRSVDHPLPGSSLSTDFGSWQLVSGCGSIQDRPVLHTDSSLPFSFQDELPNSCLLTALSDRETRLQEVRSAFLAAYSSTVGLRAATPSPSGAIGGLLEQFARGVGLRGTSTSTL" ; affx:hasCds [affx:startsAt "114157424" ; affx:stopsAt "114188450" ]; affx:hasExon [ affx:relatesToExon :Gene5390_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5390_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5390_e3; affx:cdsType "Partial" ; affx:cdsStart "114157424" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e18; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5390_e19; affx:cdsType "Partial" ; affx:cdsStop "114188450" ; affx:frame "2"] ; . :Gene5390_e1 a affx:Exon ; affx:startsAt "114145390" ; affx:stopsAt "114145619" ; affx:commonToAll "1" . :Gene5390_e2 a affx:Exon ; affx:startsAt "114147782" ; affx:stopsAt "114147931" ; affx:commonToAll "1" . :Gene5390_e3 a affx:Exon ; affx:startsAt "114157369" ; affx:stopsAt "114157478" ; affx:commonToAll "1" . :Gene5390_e4 a affx:Exon ; affx:startsAt "114161229" ; affx:stopsAt "114161305" ; affx:commonToAll "1" . :Gene5390_e5 a affx:Exon ; affx:startsAt "114161588" ; affx:stopsAt "114161649" ; affx:commonToAll "1" . :Gene5390_e6 a affx:Exon ; affx:startsAt "114163392" ; affx:stopsAt "114163515" ; affx:commonToAll "1" . :Gene5390_e7 a affx:Exon ; affx:startsAt "114164599" ; affx:stopsAt "114164673" ; affx:commonToAll "1" . :Gene5390_e8 a affx:Exon ; affx:startsAt "114168164" ; affx:stopsAt "114168235" ; affx:commonToAll "1" . :Gene5390_e9 a affx:Exon ; affx:startsAt "114168782" ; affx:stopsAt "114168857" ; affx:commonToAll "1" . :Gene5390_e10 a affx:Exon ; affx:startsAt "114173107" ; affx:stopsAt "114173174" ; affx:commonToAll "1" . :Gene5390_e11 a affx:Exon ; affx:startsAt "114173633" ; affx:stopsAt "114173719" ; affx:commonToAll "1" . :Gene5390_e12 a affx:Exon ; affx:startsAt "114173923" ; affx:stopsAt "114174000" ; affx:commonToAll "1" . :Gene5390_e13 a affx:Exon ; affx:startsAt "114174222" ; affx:stopsAt "114174259" ; affx:commonToAll "1" . :Gene5390_e14 a affx:Exon ; affx:startsAt "114176291" ; affx:stopsAt "114176359" ; affx:commonToAll "1" . :Gene5390_e15 a affx:Exon ; affx:startsAt "114177164" ; affx:stopsAt "114177223" ; affx:commonToAll "1" . :Gene5390_e16 a affx:Exon ; affx:startsAt "114177395" ; affx:stopsAt "114177534" ; affx:commonToAll "1" . :Gene5390_e17 a affx:Exon ; affx:startsAt "114178185" ; affx:stopsAt "114178365" ; affx:commonToAll "1" . :Gene5390_e18 a affx:Exon ; affx:startsAt "114185453" ; affx:stopsAt "114185609" ; affx:commonToAll "1" . :Gene5390_e19 a affx:Exon ; affx:startsAt "114188266" ; affx:stopsAt "114188866" ; affx:commonToAll "1" . :Gene5391 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18606380] . :gi18606380 a affx:Transcript ; affx:unigene "iMm.77112" ; affx:translatesTo "MTCQYQSDFLSVGGFDMEVKGWGGEDVHLYRKYLHGDLIVIRTPVPGLFHLWHEKHCADELTPEQYRMCIQSKAMNEASHSHLGMMVFREEIEMHLRKQAYRTNSETAG" ; affx:hasCds [affx:startsAt "118896778" ; affx:stopsAt "118902150" ]; affx:hasExon [ affx:relatesToExon :Gene5391_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5391_e2; affx:cdsType "Partial" ; affx:cdsStart "118896778" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5391_e3; affx:cdsType "Partial" ; affx:cdsStop "118902150" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5391_e4; affx:cdsType "None" ] ; . :Gene5391_e1 a affx:Exon ; affx:startsAt "118895084" ; affx:stopsAt "118895389" ; affx:commonToAll "1" . :Gene5391_e2 a affx:Exon ; affx:startsAt "118895493" ; affx:stopsAt "118897071" ; affx:commonToAll "1" . :Gene5391_e3 a affx:Exon ; affx:startsAt "118902113" ; affx:stopsAt "118902195" ; affx:commonToAll "1" . :Gene5391_e4 a affx:Exon ; affx:startsAt "118907357" ; affx:stopsAt "118907455" ; affx:commonToAll "1" . :Gene5392 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18605685] . :gi18605685 a affx:Transcript ; affx:unigene "iMm.25180" ; affx:translatesTo "MENRASGTTSNGETKPVCPAMEKVEEDGTLEREHWNNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLFTCGIPVFFLETALGQYTNQGGITAWRRICPIFEGIGYASQMIVSLLNVYYIVVLAWALFYLFSSFTTDLPWGSCSHEWNTENCVEFQKANDSMNVTSENATSPVIEFWERRVLKLSDGIQHLGSLRWELVLCLLLAWIICYFCIWKGVKSTGKVVYFTATFPYLMLVVLLIRGVTLPGAAQGIQFYLYPNITRLWDPQVWMDAGTQIFFSFAICLGCLTALGSYNKYHNNCYRDCIALCILNSSTSFMAGFAIFSILGFMSQEQGVPISEVAESGPGLAFIAYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREVLILIVSVISFFIGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAGRFYDNIEDMIGYKPWPLIKYCWLFFTPAVCLATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALSSMICIPAWSIYKLRTLKGPLRERLRQLVCPAEDLPQKNQPEPTAPATPMTSLLRLTELESNC" ; affx:hasCds [affx:startsAt "122110994" ; affx:stopsAt "122145489" ]; affx:hasExon [ affx:relatesToExon :Gene5392_e1; affx:cdsType "Partial" ; affx:cdsStart "122110994" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5392_e14; affx:cdsType "Partial" ; affx:cdsStop "122145489" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "12" ; affx:containsMotif [ affx:startsAt "41" ; affx:stopsAt "60" ; affx:spannedBy [ affx:startsAt "122111117" ; affx:stopsAt "122111174" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "70" ; affx:stopsAt "92" ; affx:spannedBy [ affx:startsAt "122126612" ; affx:stopsAt "122126678" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "113" ; affx:stopsAt "135" ; affx:spannedBy [ affx:startsAt "122129813" ; affx:stopsAt "122129879" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "202" ; affx:stopsAt "224" ; affx:spannedBy [ affx:startsAt "122133316" ; affx:stopsAt "122133382" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "233" ; affx:stopsAt "255" ; affx:spannedBy [ affx:startsAt "122134187" ; affx:stopsAt "122134253" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "282" ; affx:stopsAt "304" ; affx:spannedBy [ affx:startsAt "122140450" ; affx:stopsAt "122140516" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "317" ; affx:stopsAt "339" ; affx:spannedBy [ affx:startsAt "122141407" ; affx:stopsAt "122141473" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "366" ; affx:stopsAt "388" ; affx:spannedBy [ affx:startsAt "122142557" ; affx:stopsAt "122142623" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "418" ; affx:stopsAt "440" ; affx:spannedBy [ affx:startsAt "122142992" ; affx:stopsAt "122143049" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "122143692" ; affx:stopsAt "122143701" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "450" ; affx:stopsAt "472" ; affx:spannedBy [ affx:startsAt "122143731" ; affx:stopsAt "122143795" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "122144112" ; affx:stopsAt "122144114" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "491" ; affx:stopsAt "513" ; affx:spannedBy [ affx:startsAt "122144171" ; affx:stopsAt "122144213" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "122144887" ; affx:stopsAt "122144911" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "528" ; affx:stopsAt "550" ; affx:spannedBy [ affx:startsAt "122144956" ; affx:stopsAt "122145022" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5392_e1 a affx:Exon ; affx:startsAt "122110987" ; affx:stopsAt "122111196" ; affx:commonToAll "1" . :Gene5392_e2 a affx:Exon ; affx:startsAt "122126604" ; affx:stopsAt "122126739" ; affx:commonToAll "1" . :Gene5392_e3 a affx:Exon ; affx:startsAt "122129811" ; affx:stopsAt "122129952" ; affx:commonToAll "1" . :Gene5392_e4 a affx:Exon ; affx:startsAt "122132514" ; affx:stopsAt "122132599" ; affx:commonToAll "1" . :Gene5392_e5 a affx:Exon ; affx:startsAt "122133273" ; affx:stopsAt "122133406" ; affx:commonToAll "1" . :Gene5392_e6 a affx:Exon ; affx:startsAt "122134184" ; affx:stopsAt "122134319" ; affx:commonToAll "1" . :Gene5392_e7 a affx:Exon ; affx:startsAt "122140435" ; affx:stopsAt "122140539" ; affx:commonToAll "1" . :Gene5392_e8 a affx:Exon ; affx:startsAt "122141391" ; affx:stopsAt "122141516" ; affx:commonToAll "1" . :Gene5392_e9 a affx:Exon ; affx:startsAt "122142519" ; affx:stopsAt "122142632" ; affx:commonToAll "1" . :Gene5392_e10 a affx:Exon ; affx:startsAt "122142911" ; affx:stopsAt "122143049" ; affx:commonToAll "1" . :Gene5392_e11 a affx:Exon ; affx:startsAt "122143692" ; affx:stopsAt "122143795" ; affx:commonToAll "1" . :Gene5392_e12 a affx:Exon ; affx:startsAt "122144112" ; affx:stopsAt "122144213" ; affx:commonToAll "1" . :Gene5392_e13 a affx:Exon ; affx:startsAt "122144887" ; affx:stopsAt "122145058" ; affx:commonToAll "1" . :Gene5392_e14 a affx:Exon ; affx:startsAt "122145366" ; affx:stopsAt "122145794" ; affx:commonToAll "1" . :Gene5393 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18606499] . :gi18606499 a affx:Transcript ; affx:unigene "iMm.95398" ; affx:translatesTo "MPVINIEDLTEKDKLKMEVDQLKKEVTLERMMVSG" ; affx:hasCds [affx:startsAt "3695326" ; affx:stopsAt "3695434" ]; affx:hasExon [ affx:relatesToExon :Gene5393_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5393_e2; affx:cdsType "Partial" ; affx:cdsStart "3695326" ; affx:cdsStop "3695434" ; affx:frame "0"] ; . :Gene5393_e1 a affx:Exon ; affx:startsAt "3695124" ; affx:stopsAt "3695189" ; affx:commonToAll "1" . :Gene5393_e2 a affx:Exon ; affx:startsAt "3695319" ; affx:stopsAt "3698005" ; affx:commonToAll "1" . :Gene5394 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18256042] . :gi18256042 a affx:Transcript ; affx:unigene "iMm.17403" ; affx:translatesTo "MPCLLPSLLRATRAALPLLSPPRVVAASASQRLLSAPAQPAASRSSMDSAEELLAPLRLAVRQQGDFVRKLKEDKAPQVDVDRAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPTTGNDLSPPVPFNLMFQTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPTEKDHPKFQSVADLCLYLYSAKAQVTGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEMELLLSEKGEFTIETEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTILEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPNVVRDLANGNITWADVEARYPLFEGQETGKKETVEE" ; affx:hasCds [affx:startsAt "55440023" ; affx:stopsAt "55481289" ]; affx:hasExon [ affx:relatesToExon :Gene5394_e1; affx:cdsType "Partial" ; affx:cdsStart "55440023" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5394_e17; affx:cdsType "Partial" ; affx:cdsStop "55481289" ; affx:frame "1"] ; . :Gene5394_e1 a affx:Exon ; affx:startsAt "55440012" ; affx:stopsAt "55440215" ; affx:commonToAll "1" . :Gene5394_e2 a affx:Exon ; affx:startsAt "55448395" ; affx:stopsAt "55448497" ; affx:commonToAll "1" . :Gene5394_e3 a affx:Exon ; affx:startsAt "55450048" ; affx:stopsAt "55450151" ; affx:commonToAll "1" . :Gene5394_e4 a affx:Exon ; affx:startsAt "55452262" ; affx:stopsAt "55452404" ; affx:commonToAll "1" . :Gene5394_e5 a affx:Exon ; affx:startsAt "55454118" ; affx:stopsAt "55454207" ; affx:commonToAll "1" . :Gene5394_e6 a affx:Exon ; affx:startsAt "55455071" ; affx:stopsAt "55455148" ; affx:commonToAll "1" . :Gene5394_e7 a affx:Exon ; affx:startsAt "55457692" ; affx:stopsAt "55457838" ; affx:commonToAll "1" . :Gene5394_e8 a affx:Exon ; affx:startsAt "55462852" ; affx:stopsAt "55463002" ; affx:commonToAll "1" . :Gene5394_e9 a affx:Exon ; affx:startsAt "55465034" ; affx:stopsAt "55465197" ; affx:commonToAll "1" . :Gene5394_e10 a affx:Exon ; affx:startsAt "55467391" ; affx:stopsAt "55467556" ; affx:commonToAll "1" . :Gene5394_e11 a affx:Exon ; affx:startsAt "55470004" ; affx:stopsAt "55470112" ; affx:commonToAll "1" . :Gene5394_e12 a affx:Exon ; affx:startsAt "55471284" ; affx:stopsAt "55471430" ; affx:commonToAll "1" . :Gene5394_e13 a affx:Exon ; affx:startsAt "55475282" ; affx:stopsAt "55475368" ; affx:commonToAll "1" . :Gene5394_e14 a affx:Exon ; affx:startsAt "55477325" ; affx:stopsAt "55477435" ; affx:commonToAll "1" . :Gene5394_e15 a affx:Exon ; affx:startsAt "55478898" ; affx:stopsAt "55478992" ; affx:commonToAll "1" . :Gene5394_e16 a affx:Exon ; affx:startsAt "55479526" ; affx:stopsAt "55479717" ; affx:commonToAll "1" . :Gene5394_e17 a affx:Exon ; affx:startsAt "55481163" ; affx:stopsAt "55481444" ; affx:commonToAll "1" . :Gene5395 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18490510] . :gi18490510 a affx:Transcript ; affx:unigene "iMm.45116" ; affx:translatesTo "MQEDLLEEQKDGARAAAVADKKKGLIGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG" ; affx:hasCds [affx:startsAt "114279017" ; affx:stopsAt "114288927" ]; affx:hasExon [ affx:relatesToExon :Gene5395_e1; affx:cdsType "Partial" ; affx:cdsStart "114279017" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5395_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5395_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5395_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5395_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5395_e6; affx:cdsType "Partial" ; affx:cdsStop "114288927" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5395_e7; affx:cdsType "None" ] ; . :Gene5395_e1 a affx:Exon ; affx:startsAt "114278672" ; affx:stopsAt "114279210" ; affx:commonToAll "1" . :Gene5395_e2 a affx:Exon ; affx:startsAt "114282251" ; affx:stopsAt "114282437" ; affx:commonToAll "1" . :Gene5395_e3 a affx:Exon ; affx:startsAt "114282968" ; affx:stopsAt "114283078" ; affx:commonToAll "1" . :Gene5395_e4 a affx:Exon ; affx:startsAt "114284307" ; affx:stopsAt "114284411" ; affx:commonToAll "1" . :Gene5395_e5 a affx:Exon ; affx:startsAt "114284494" ; affx:stopsAt "114284594" ; affx:commonToAll "1" . :Gene5395_e6 a affx:Exon ; affx:startsAt "114288921" ; affx:stopsAt "114288975" ; affx:commonToAll "1" . :Gene5395_e7 a affx:Exon ; affx:startsAt "114289345" ; affx:stopsAt "114289547" ; affx:commonToAll "1" . :Gene5396 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18257349] . :gi18257349 a affx:Transcript ; affx:unigene "iMm.7190" ; affx:translatesTo "MSLAFGWAAVILLLQTADTASAVTTPHDKARIFADLSPQEIKAVHSFLMSRKELGLESSKNLTLAKNSVFLIEMLLPKKKNVLKFLDEGRKSPVREARAIIFFGAQDHPNVTEFAVGPLPRPCYVQALSPRPGHHLSWSSRPISTAEYDLLYHMLNRAITPLHQFFLDTTGFSFLGCDDRFLTFTDVAPRGVESGQRRSWLIVQRYVEGYFLHPTGLEILVDHSSTDVQDWRVEQLWYNGKFYNSPEELAQKYAVGEVEAVVLEEVVLEDPLPGATEQPPLFSSYKPRGEFHTPVTVAGPHVVQPSGPRYKLEGNVVLYGDWSFSYRLRSSSGLQIFNVLFGGERVAYEVSVQEAVALYGGHTPAGMQTKYIDVGWGLGSVTHELAPGIDCPETATFLDAFHYYDSDGPVLYPRALCLFEMPTGVPLRRHFDSNFKGGFNFYAGLKGYVLVLRTTSTVYNYDYIWDFIFYPNGVMETKMHATGYVHATFYTPEGLRHGTRLQTHLLGNIHTHLVHYRVDLDVAGTKNSFRTLKTKLENITNPWSPSHSLVQPTLEQTQYSHEHQAAFRFGQTLPKYLLFSSPQKNRWGHRRSYRLQIHSMAEQVLPPGWQEERAVTWARYPLAVTKYRESERYSSSLYNQNDPWDPPVVFEEFLRNNENIENEDLVAWVTVGFLHIPHSEDVPNTATPGNCVGFLIRPFNFFEEDPSLASRDTVIVWPQDNGLNHVQRWIPENRDCLVSPPFSYNGTYKPV" ; affx:hasCds [affx:startsAt "49255079" ; affx:stopsAt "49258706" ]; affx:hasExon [ affx:relatesToExon :Gene5396_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5396_e2; affx:cdsType "Partial" ; affx:cdsStart "49255079" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5396_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5396_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5396_e5; affx:cdsType "Partial" ; affx:cdsStop "49258706" ; affx:frame "0"] ; . :Gene5396_e1 a affx:Exon ; affx:startsAt "49245122" ; affx:stopsAt "49245167" ; affx:commonToAll "1" . :Gene5396_e2 a affx:Exon ; affx:startsAt "49255060" ; affx:stopsAt "49256649" ; affx:commonToAll "1" . :Gene5396_e3 a affx:Exon ; affx:startsAt "49257482" ; affx:stopsAt "49257768" ; affx:commonToAll "1" . :Gene5396_e4 a affx:Exon ; affx:startsAt "49258076" ; affx:stopsAt "49258209" ; affx:commonToAll "1" . :Gene5396_e5 a affx:Exon ; affx:startsAt "49258439" ; affx:stopsAt "49259061" ; affx:commonToAll "1" . :Gene5397 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18314670] . :gi18314670 a affx:Transcript ; affx:unigene "iMm.21501" ; affx:translatesTo "MGGTASTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSSVYGASVSDEDLKRRVAEELALEQAKKESEHQRRLKQARDLERERAAANEQLTRAVLRERISSEEERMKAKHLARQLEEKDRVMRKQDAFYKEQLARLEERSSEFYKVTTEEYQKAAEEVEAKFKRYEYHPVCADLQTKILQCYRQNTQQTLSCSALASQYMHCVNHAKQSMLEKGG" ; affx:hasCds [affx:startsAt "32948537" ; affx:stopsAt "33220211" ]; affx:hasExon [ affx:relatesToExon :Gene5397_e1; affx:cdsType "Partial" ; affx:cdsStart "32948537" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5397_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5397_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5397_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5397_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5397_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5397_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5397_e8; affx:cdsType "Partial" ; affx:cdsStop "33220211" ; affx:frame "2"] ; . :Gene5397_e1 a affx:Exon ; affx:startsAt "32948275" ; affx:stopsAt "32948561" ; affx:commonToAll "1" . :Gene5397_e2 a affx:Exon ; affx:startsAt "32959510" ; affx:stopsAt "32959646" ; affx:commonToAll "1" . :Gene5397_e3 a affx:Exon ; affx:startsAt "33007715" ; affx:stopsAt "33007786" ; affx:commonToAll "1" . :Gene5397_e4 a affx:Exon ; affx:startsAt "33047961" ; affx:stopsAt "33048045" ; affx:commonToAll "1" . :Gene5397_e5 a affx:Exon ; affx:startsAt "33127842" ; affx:stopsAt "33127960" ; affx:commonToAll "1" . :Gene5397_e6 a affx:Exon ; affx:startsAt "33168221" ; affx:stopsAt "33168303" ; affx:commonToAll "1" . :Gene5397_e7 a affx:Exon ; affx:startsAt "33208770" ; affx:stopsAt "33208858" ; affx:commonToAll "1" . :Gene5397_e8 a affx:Exon ; affx:startsAt "33220130" ; affx:stopsAt "33220335" ; affx:commonToAll "1" . :Gene5398 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18381092] . :gi18381092 a affx:Transcript ; affx:unigene "iMm.41574" ; affx:translatesTo "MAAALARLGLRPVKLVRVQFCPFEKNVESTRTFLQTVSSEKVRATNLNCSVIADVRHDGSEPCVDVLFGDGYRLIMRGAHLTTQEMLSALASHIRDRNAAAASAPGADKVAPGTSTRR" ; affx:hasCds [affx:startsAt "83997511" ; affx:stopsAt "83998073" ]; affx:hasExon [ affx:relatesToExon :Gene5398_e1; affx:cdsType "Partial" ; affx:cdsStart "83997511" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5398_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5398_e3; affx:cdsType "Partial" ; affx:cdsStop "83998073" ; affx:frame "1"] ; . :Gene5398_e1 a affx:Exon ; affx:startsAt "83997494" ; affx:stopsAt "83997603" ; affx:commonToAll "1" . :Gene5398_e2 a affx:Exon ; affx:startsAt "83997713" ; affx:stopsAt "83997826" ; affx:commonToAll "1" . :Gene5398_e3 a affx:Exon ; affx:startsAt "83997921" ; affx:stopsAt "83998339" ; affx:commonToAll "1" . :Gene5399 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18043490] . :gi18043490 a affx:Transcript ; affx:unigene "iMm.3085" ; affx:translatesTo "MKALNIDRCQSLIRLSLPTRTAWTMPACSLFQAAQHTLGEVAISQNTTSSTWQREFLLQPPSSCLCPSSRGGLGHQQFQTRSAVSRLIGQWQHGQCPLPTERWREGDRLGVPGPRKGRKARMQGCSWTTQSSWKCF" ; affx:hasCds [affx:startsAt "116742390" ; affx:stopsAt "116742802" ]; affx:hasExon [ affx:relatesToExon :Gene5399_e1; affx:cdsType "Partial" ; affx:cdsStart "116742390" ; affx:cdsStop "116742475" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5399_e2; affx:cdsType "None" ] ; . :Gene5399_e1 a affx:Exon ; affx:startsAt "116742097" ; affx:stopsAt "116743143" ; affx:commonToAll "1" . :Gene5399_e2 a affx:Exon ; affx:startsAt "116743291" ; affx:stopsAt "116743305" ; affx:commonToAll "1" . :Gene5400 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18043688] . :gi18043688 a affx:Transcript ; affx:unigene "iMm.28916" ; affx:translatesTo "MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGNQEKAGEDGQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEAKRLLGY" ; affx:hasCds [affx:startsAt "88688687" ; affx:stopsAt "88708242" ]; affx:hasExon [ affx:relatesToExon :Gene5400_e1; affx:cdsType "Partial" ; affx:cdsStart "88688687" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5400_e11; affx:cdsType "Partial" ; affx:cdsStop "88708242" ; affx:frame "2"] ; . :Gene5400_e1 a affx:Exon ; affx:startsAt "88688285" ; affx:stopsAt "88688795" ; affx:commonToAll "1" . :Gene5400_e2 a affx:Exon ; affx:startsAt "88689148" ; affx:stopsAt "88689235" ; affx:commonToAll "1" . :Gene5400_e3 a affx:Exon ; affx:startsAt "88691099" ; affx:stopsAt "88691221" ; affx:commonToAll "1" . :Gene5400_e4 a affx:Exon ; affx:startsAt "88691931" ; affx:stopsAt "88692054" ; affx:commonToAll "1" . :Gene5400_e5 a affx:Exon ; affx:startsAt "88694962" ; affx:stopsAt "88695080" ; affx:commonToAll "1" . :Gene5400_e6 a affx:Exon ; affx:startsAt "88697175" ; affx:stopsAt "88697288" ; affx:commonToAll "1" . :Gene5400_e7 a affx:Exon ; affx:startsAt "88703237" ; affx:stopsAt "88703280" ; affx:commonToAll "1" . :Gene5400_e8 a affx:Exon ; affx:startsAt "88704023" ; affx:stopsAt "88704089" ; affx:commonToAll "1" . :Gene5400_e9 a affx:Exon ; affx:startsAt "88704538" ; affx:stopsAt "88704590" ; affx:commonToAll "1" . :Gene5400_e10 a affx:Exon ; affx:startsAt "88705323" ; affx:stopsAt "88705346" ; affx:commonToAll "1" . :Gene5400_e11 a affx:Exon ; affx:startsAt "88708239" ; affx:stopsAt "88708319" ; affx:commonToAll "1" . :Gene5401 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18043855] . :gi18043855 a affx:Transcript ; affx:unigene "iMm.130433" ; affx:translatesTo "MLSGSGSQGRRCLATLSQIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEAHVQNSVPDEESKPASSNTQVEGDEEAALLERLARREERRQKRLQEALERQKEFDPTITDGSLSGPSRRMQNDSAENETAEGEEKRESRSGRYEVEETEVVIKSYQKNSYQDAEDKKKEEKEEEEQEKLKGGSLGENQIKDEKIKKDKEPKEEVKSFLDRKKGFTEVKAQNGEFMTHKLKQTENAFSPSRSGGRASGDKEAEGAPQVEAGKRLEELRRRRGETENEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKAREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSEDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSGVRSTHQAAVVSKIDSRLEQYTNAIEGTKASKPMKPAASDLPVPAEGVRNIKSMWEKGSVFSAPSASGTPNKETAGLKVGVSSRINEWLTKSPDGNKSPAPKPSDLRPGDVSGKRNLWEKQSVDKVTSPTKV" ; affx:hasCds [affx:startsAt "34886853" ; affx:stopsAt "34950640" ]; affx:hasExon [ affx:relatesToExon :Gene5401_e1; affx:cdsType "Partial" ; affx:cdsStart "34886853" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5401_e12; affx:cdsType "Partial" ; affx:cdsStop "34950640" ; affx:frame "2"] ; . :Gene5401_e1 a affx:Exon ; affx:startsAt "34886693" ; affx:stopsAt "34886906" ; affx:commonToAll "1" . :Gene5401_e2 a affx:Exon ; affx:startsAt "34919200" ; affx:stopsAt "34919347" ; affx:commonToAll "1" . :Gene5401_e3 a affx:Exon ; affx:startsAt "34923030" ; affx:stopsAt "34923427" ; affx:commonToAll "1" . :Gene5401_e4 a affx:Exon ; affx:startsAt "34930854" ; affx:stopsAt "34931000" ; affx:commonToAll "1" . :Gene5401_e5 a affx:Exon ; affx:startsAt "34933045" ; affx:stopsAt "34933310" ; affx:commonToAll "1" . :Gene5401_e6 a affx:Exon ; affx:startsAt "34935395" ; affx:stopsAt "34935536" ; affx:commonToAll "1" . :Gene5401_e7 a affx:Exon ; affx:startsAt "34939521" ; affx:stopsAt "34939565" ; affx:commonToAll "1" . :Gene5401_e8 a affx:Exon ; affx:startsAt "34939662" ; affx:stopsAt "34939741" ; affx:commonToAll "1" . :Gene5401_e9 a affx:Exon ; affx:startsAt "34942367" ; affx:stopsAt "34942505" ; affx:commonToAll "1" . :Gene5401_e10 a affx:Exon ; affx:startsAt "34943514" ; affx:stopsAt "34943610" ; affx:commonToAll "1" . :Gene5401_e11 a affx:Exon ; affx:startsAt "34948459" ; affx:stopsAt "34948540" ; affx:commonToAll "1" . :Gene5401_e12 a affx:Exon ; affx:startsAt "34950634" ; affx:stopsAt "34951512" ; affx:commonToAll "1" . :Gene5402 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18044821] . :gi18044821 a affx:Transcript ; affx:unigene "iMm.21695" ; affx:translatesTo "MSGTKPDILWAPHQVDRFVVCDSELSLYHVESAVNSELKAGSLRLSEDSAATLLSINSDTPYMKCVAWYLNYDPECLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSKYTPDIVPMEKVRLSAGEAETTLLVTKPLYELGQNDASLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFVNTKAVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTGLLATLTRDSNIIRLYDMQHTPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDFTVFERISLAWSPITSLMWACGRHLYECAEEESDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNEDPQLKSLWYTLHFMKQYTEDNDQKSPGNKGSLVYAGIKSIVKSSLGMVESSRHNWSGLDKQTDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAAAVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSEAGAYDGVLYENKVAVRDRVAFACKFLGDAQLNKYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSSVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGSKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP" ; affx:hasCds [affx:startsAt "7968265" ; affx:stopsAt "7988945" ]; affx:hasExon [ affx:relatesToExon :Gene5402_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5402_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5402_e3; affx:cdsType "Partial" ; affx:cdsStart "7968265" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5402_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5402_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5402_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5402_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5402_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5402_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5402_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5402_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5402_e12; affx:cdsType "Partial" ; affx:cdsStop "7988945" ; affx:frame "1"] ; . :Gene5402_e1 a affx:Exon ; affx:startsAt "7961858" ; affx:stopsAt "7962041" ; affx:commonToAll "1" . :Gene5402_e2 a affx:Exon ; affx:startsAt "7964209" ; affx:stopsAt "7964268" ; affx:commonToAll "1" . :Gene5402_e3 a affx:Exon ; affx:startsAt "7968225" ; affx:stopsAt "7969559" ; affx:commonToAll "1" . :Gene5402_e4 a affx:Exon ; affx:startsAt "7969831" ; affx:stopsAt "7969930" ; affx:commonToAll "1" . :Gene5402_e5 a affx:Exon ; affx:startsAt "7975922" ; affx:stopsAt "7976177" ; affx:commonToAll "1" . :Gene5402_e6 a affx:Exon ; affx:startsAt "7978016" ; affx:stopsAt "7978186" ; affx:commonToAll "1" . :Gene5402_e7 a affx:Exon ; affx:startsAt "7980306" ; affx:stopsAt "7980372" ; affx:commonToAll "1" . :Gene5402_e8 a affx:Exon ; affx:startsAt "7981431" ; affx:stopsAt "7981590" ; affx:commonToAll "1" . :Gene5402_e9 a affx:Exon ; affx:startsAt "7984623" ; affx:stopsAt "7984776" ; affx:commonToAll "1" . :Gene5402_e10 a affx:Exon ; affx:startsAt "7986513" ; affx:stopsAt "7986718" ; affx:commonToAll "1" . :Gene5402_e11 a affx:Exon ; affx:startsAt "7987695" ; affx:stopsAt "7987825" ; affx:commonToAll "1" . :Gene5402_e12 a affx:Exon ; affx:startsAt "7988848" ; affx:stopsAt "7989738" ; affx:commonToAll "1" . :Gene5403 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi1049226] ; affx:hasVariant [affx:representedBy :gi198971] . :gi1049226 a affx:Transcript ; affx:unigene "iMm.1858" ; affx:translatesTo "MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFSCDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV" ; affx:hasCds [affx:startsAt "72248361" ; affx:stopsAt "72251720" ]; affx:hasExon [ affx:relatesToExon :Gene5403_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5403_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5403_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5403_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5403_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "27" ; affx:spannedBy [ affx:startsAt "72248361" ; affx:stopsAt "72248442" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "195" ; affx:stopsAt "217" ; affx:spannedBy [ affx:startsAt "72249602" ; affx:stopsAt "72249668" ; affx:inFrame "1" ] ; ] ; ] ; . :gi198971 a affx:Transcript ; affx:unigene "iMm.1858" ; affx:translatesTo "MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFSCDIYIWAPLAGICVALLLSLIITLICYHSR" ; affx:hasCds [affx:startsAt "72248361" ; affx:stopsAt "72251676" ]; affx:hasExon [ affx:relatesToExon :Gene5403_e1; affx:cdsType "Partial" ; affx:cdsStart "72248361" ; affx:cdsStop "72248601" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5403_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5403_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5403_e7; affx:cdsType "Partial" ; affx:cdsStop "72251676" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "27" ; affx:spannedBy [ affx:startsAt "72248361" ; affx:stopsAt "72248442" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "194" ; affx:stopsAt "216" ; affx:spannedBy [ affx:startsAt "72249602" ; affx:stopsAt "72249668" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene5403_e1 a affx:Exon ; affx:startsAt "72248349" ; affx:stopsAt "72248806" ; affx:commonToAll "0" . :Gene5403_e2 a affx:Exon ; affx:startsAt "72248361" ; affx:stopsAt "72248806" ; affx:commonToAll "0" . :Gene5403_e3 a affx:Exon ; affx:startsAt "72249311" ; affx:stopsAt "72249416" ; affx:commonToAll "1" . :Gene5403_e4 a affx:Exon ; affx:startsAt "72249567" ; affx:stopsAt "72249678" ; affx:commonToAll "1" . :Gene5403_e5 a affx:Exon ; affx:startsAt "72250696" ; affx:stopsAt "72250727" ; affx:commonToAll "0" . :Gene5403_e6 a affx:Exon ; affx:startsAt "72251668" ; affx:stopsAt "72251720" ; affx:commonToAll "0" . :Gene5403_e7 a affx:Exon ; affx:startsAt "72251668" ; affx:stopsAt "72251767" ; affx:commonToAll "0" . :TEFR1b a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi1161131] . :gi1161131 a affx:Transcript ; affx:unigene "iMm.14774" ; affx:translatesTo "ITSNEWSSPDSPEGSSISGGSQALDKPIDNDAEGVWSPEIERSFQEALAIYPPCGRRKIILTEEGKMYGRNELIARHIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKFWQGALPGQPGTSHDVKPFSQNTYPVQPPLPLPGFESPAGPTPSPSAPLAPPWQGRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE" ; affx:hasCds [affx:startsAt "129149440" ; affx:stopsAt "129192191" ]; affx:hasExon [ affx:relatesToExon :TEFR1b_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e2; affx:cdsType "Partial" ; affx:cdsStart "129149440" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e11; affx:cdsType "Partial" ; affx:cdsStop "129192191" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :TEFR1b_e12; affx:cdsType "None" ] ; . :TEFR1b_e1 a affx:Exon ; affx:startsAt "129145362" ; affx:stopsAt "129145744" ; affx:commonToAll "1" . :TEFR1b_e2 a affx:Exon ; affx:startsAt "129149435" ; affx:stopsAt "129149554" ; affx:commonToAll "1" . :TEFR1b_e3 a affx:Exon ; affx:startsAt "129149642" ; affx:stopsAt "129149795" ; affx:commonToAll "1" . :TEFR1b_e4 a affx:Exon ; affx:startsAt "129151836" ; affx:stopsAt "129151977" ; affx:commonToAll "1" . :TEFR1b_e5 a affx:Exon ; affx:startsAt "129163592" ; affx:stopsAt "129163766" ; affx:commonToAll "1" . :TEFR1b_e6 a affx:Exon ; affx:startsAt "129164561" ; affx:stopsAt "129164701" ; affx:commonToAll "1" . :TEFR1b_e7 a affx:Exon ; affx:startsAt "129167460" ; affx:stopsAt "129167516" ; affx:commonToAll "1" . :TEFR1b_e8 a affx:Exon ; affx:startsAt "129167957" ; affx:stopsAt "129168001" ; affx:commonToAll "1" . :TEFR1b_e9 a affx:Exon ; affx:startsAt "129172561" ; affx:stopsAt "129172624" ; affx:commonToAll "1" . :TEFR1b_e10 a affx:Exon ; affx:startsAt "129172943" ; affx:stopsAt "129173008" ; affx:commonToAll "1" . :TEFR1b_e11 a affx:Exon ; affx:startsAt "129191986" ; affx:stopsAt "129192241" ; affx:commonToAll "1" . :TEFR1b_e12 a affx:Exon ; affx:startsAt "129196570" ; affx:stopsAt "129196696" ; affx:commonToAll "1" . :Gene5405 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi790853] . :gi790853 a affx:Transcript ; affx:unigene "iMm.4611" ; affx:translatesTo "MCGRRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHKPRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDEHLMHGTHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA" ; affx:hasCds [affx:startsAt "52465962" ; affx:stopsAt "52579733" ]; affx:hasExon [ affx:relatesToExon :Gene5405_e1; affx:cdsType "Partial" ; affx:cdsStart "52465962" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5405_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5405_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5405_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5405_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5405_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5405_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5405_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5405_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5405_e10; affx:cdsType "Partial" ; affx:cdsStop "52579733" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "22" ; affx:spannedBy [ affx:startsAt "52579678" ; affx:stopsAt "52579733" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "52579493" ; affx:stopsAt "52579504" ; affx:inFrame "1" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "232" ; affx:stopsAt "254" ; affx:spannedBy [ affx:startsAt "52472773" ; affx:stopsAt "52472839" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "261" ; affx:stopsAt "283" ; affx:spannedBy [ affx:startsAt "52472742" ; affx:stopsAt "52472752" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "52471747" ; affx:stopsAt "52471803" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "293" ; affx:stopsAt "315" ; affx:spannedBy [ affx:startsAt "52470563" ; affx:stopsAt "52470628" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5405_e1 a affx:Exon ; affx:startsAt "52465673" ; affx:stopsAt "52466481" ; affx:commonToAll "1" . :Gene5405_e2 a affx:Exon ; affx:startsAt "52470518" ; affx:stopsAt "52470628" ; affx:commonToAll "1" . :Gene5405_e3 a affx:Exon ; affx:startsAt "52471716" ; affx:stopsAt "52471803" ; affx:commonToAll "1" . :Gene5405_e4 a affx:Exon ; affx:startsAt "52472742" ; affx:stopsAt "52472937" ; affx:commonToAll "1" . :Gene5405_e5 a affx:Exon ; affx:startsAt "52474290" ; affx:stopsAt "52474458" ; affx:commonToAll "1" . :Gene5405_e6 a affx:Exon ; affx:startsAt "52477135" ; affx:stopsAt "52477215" ; affx:commonToAll "1" . :Gene5405_e7 a affx:Exon ; affx:startsAt "52515828" ; affx:stopsAt "52515938" ; affx:commonToAll "1" . :Gene5405_e8 a affx:Exon ; affx:startsAt "52526782" ; affx:stopsAt "52526827" ; affx:commonToAll "1" . :Gene5405_e9 a affx:Exon ; affx:startsAt "52579364" ; affx:stopsAt "52579504" ; affx:commonToAll "1" . :Gene5405_e10 a affx:Exon ; affx:startsAt "52579678" ; affx:stopsAt "52579783" ; affx:commonToAll "1" . :Fxyd7 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi11612660] . :gi11612660 a affx:Transcript ; affx:unigene "iMm.41770" ; affx:translatesTo "MATPTQSPTNVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIILSKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV" ; affx:hasCds [affx:startsAt "23316504" ; affx:stopsAt "23325011" ]; affx:hasExon [ affx:relatesToExon :Fxyd7_e1; affx:cdsType "Partial" ; affx:cdsStart "23316504" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Fxyd7_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Fxyd7_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Fxyd7_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Fxyd7_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Fxyd7_e6; affx:cdsType "Partial" ; affx:cdsStop "23325011" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "23" ; affx:stopsAt "45" ; affx:spannedBy [ affx:startsAt "23318576" ; affx:stopsAt "23318642" ; affx:inFrame "1" ] ; ] ; ] ; . :Fxyd7_e1 a affx:Exon ; affx:startsAt "23316137" ; affx:stopsAt "23316527" ; affx:commonToAll "1" . :Fxyd7_e2 a affx:Exon ; affx:startsAt "23318193" ; affx:stopsAt "23318234" ; affx:commonToAll "1" . :Fxyd7_e3 a affx:Exon ; affx:startsAt "23318330" ; affx:stopsAt "23318373" ; affx:commonToAll "1" . :Fxyd7_e4 a affx:Exon ; affx:startsAt "23318575" ; affx:stopsAt "23318650" ; affx:commonToAll "1" . :Fxyd7_e5 a affx:Exon ; affx:startsAt "23320996" ; affx:stopsAt "23321026" ; affx:commonToAll "1" . :Fxyd7_e6 a affx:Exon ; affx:startsAt "23324980" ; affx:stopsAt "23325079" ; affx:commonToAll "1" . :Fxyd1 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi9506704] . :gi9506704 a affx:Transcript ; affx:unigene "iMm.1491" ; affx:translatesTo "MASPGHILALCVCLLSMASAEAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSSRRR" ; affx:hasCds [affx:startsAt "23325590" ; affx:stopsAt "23327992" ]; affx:hasExon [ affx:relatesToExon :Fxyd1_e1; affx:cdsType "Partial" ; affx:cdsStart "23325590" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Fxyd1_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Fxyd1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Fxyd1_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Fxyd1_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Fxyd1_e6; affx:cdsType "Partial" ; affx:cdsStop "23327992" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Fxyd1_e7; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "62" ; affx:spannedBy [ affx:startsAt "23327931" ; affx:stopsAt "23327992" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "23327518" ; affx:stopsAt "23327551" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "23327025" ; affx:stopsAt "23327100" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "23326670" ; affx:stopsAt "23326687" ; affx:inFrame "1" ] ; ] ; ] ; . :Fxyd1_e1 a affx:Exon ; affx:startsAt "23325332" ; affx:stopsAt "23325613" ; affx:commonToAll "1" . :Fxyd1_e2 a affx:Exon ; affx:startsAt "23325753" ; affx:stopsAt "23325803" ; affx:commonToAll "1" . :Fxyd1_e3 a affx:Exon ; affx:startsAt "23326650" ; affx:stopsAt "23326687" ; affx:commonToAll "1" . :Fxyd1_e4 a affx:Exon ; affx:startsAt "23327025" ; affx:stopsAt "23327100" ; affx:commonToAll "1" . :Fxyd1_e5 a affx:Exon ; affx:startsAt "23327518" ; affx:stopsAt "23327551" ; affx:commonToAll "1" . :Fxyd1_e6 a affx:Exon ; affx:startsAt "23327931" ; affx:stopsAt "23327996" ; affx:commonToAll "1" . :Fxyd1_e7 a affx:Exon ; affx:startsAt "23329176" ; affx:stopsAt "23329208" ; affx:commonToAll "1" . :Gene5408 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13879459] . :gi13879459 a affx:Transcript ; affx:unigene "iMm.24972" ; affx:translatesTo "MATEEAIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPVRMVTVPPRHYCIVANPVSRDAQSSVLFDVTGQVRLRHADQEIRLAQDPFPLYPGELLEKDITPLQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIPQKEVEVVEIIQATVIKQNQALRLRARKECFDRDGKERVTGEEWLVRSVGAYLPAVFEEVLDLVDAVILTEKTALHLRARQNFKDLRGVAHRTGEEWLVTVQDTEAHVPDVYEEVLGVVPITTLGPRHYCVILDPMGPDGKNQLGQKRVVKGEKSFFLQPGERLERGIQDVYVLSEQQGLLLKALQPLEEGEGEEKVAHQAGDRWLIRGPLEYVPSAKVEVVEERQAIPLDQNEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPSGVEELLNLGHDPLADRGQKGTAKVLQPSAARNKTRVVSYRVPHNAAVQVYDYRAKRARVVFGPELVSLDPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFELKNRNDPEETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRMAVFGFEMSEDAGPDGALLPRARDRAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEAMSMAVESTGNAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELERVKKVREMELIYSRAQLELEVSKAQQLADVEAKKFKEMTEALGPGTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSSPINLFNTAFGLLGLGSDGQPPVQK" ; affx:hasCds [affx:startsAt "116841122" ; affx:stopsAt "116856073" ]; affx:hasExon [ affx:relatesToExon :Gene5408_e1; affx:cdsType "Partial" ; affx:cdsStart "116841122" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e14; affx:cdsType "Partial" ; affx:cdsStop "116856073" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5408_e15; affx:cdsType "None" ] ; . :Gene5408_e1 a affx:Exon ; affx:startsAt "116841005" ; affx:stopsAt "116841254" ; affx:commonToAll "1" . :Gene5408_e2 a affx:Exon ; affx:startsAt "116841616" ; affx:stopsAt "116841805" ; affx:commonToAll "1" . :Gene5408_e3 a affx:Exon ; affx:startsAt "116842457" ; affx:stopsAt "116842584" ; affx:commonToAll "1" . :Gene5408_e4 a affx:Exon ; affx:startsAt "116842965" ; affx:stopsAt "116843082" ; affx:commonToAll "1" . :Gene5408_e5 a affx:Exon ; affx:startsAt "116843685" ; affx:stopsAt "116844072" ; affx:commonToAll "1" . :Gene5408_e6 a affx:Exon ; affx:startsAt "116846414" ; affx:stopsAt "116846612" ; affx:commonToAll "1" . :Gene5408_e7 a affx:Exon ; affx:startsAt "116846693" ; affx:stopsAt "116846938" ; affx:commonToAll "1" . :Gene5408_e8 a affx:Exon ; affx:startsAt "116847659" ; affx:stopsAt "116847941" ; affx:commonToAll "1" . :Gene5408_e9 a affx:Exon ; affx:startsAt "116849875" ; affx:stopsAt "116850112" ; affx:commonToAll "1" . :Gene5408_e10 a affx:Exon ; affx:startsAt "116850377" ; affx:stopsAt "116850472" ; affx:commonToAll "1" . :Gene5408_e11 a affx:Exon ; affx:startsAt "116852365" ; affx:stopsAt "116852497" ; affx:commonToAll "1" . :Gene5408_e12 a affx:Exon ; affx:startsAt "116852612" ; affx:stopsAt "116852736" ; affx:commonToAll "1" . :Gene5408_e13 a affx:Exon ; affx:startsAt "116855619" ; affx:stopsAt "116855815" ; affx:commonToAll "1" . :Gene5408_e14 a affx:Exon ; affx:startsAt "116855948" ; affx:stopsAt "116856098" ; affx:commonToAll "1" . :Gene5408_e15 a affx:Exon ; affx:startsAt "116868658" ; affx:stopsAt "116868699" ; affx:commonToAll "1" . :Nap1 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi18027487] . :gi18027487 a affx:Transcript ; affx:unigene "iMm.1566" ; affx:translatesTo "MSLLATLGLELDRALLPASGLGWLVDYGKLPLAPAPLGPYEVLGGALEGGLPGGGEPLAGDGFSDWMTERVDFTALLPLEAPLPPGTLPPPSPAPPDLEAMASLLKKELEQMEDFFLDAPLLPPPSPPPPPPPAAAPSLPLPLPLPTFDLPQPPTLDTLDLLAVYCRSEAGPGDSGLSTLPVPQQPPPLAPLPSPARPAPYPSPASTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELRERAESVEREIQYVKDLLIEVYKARSQRTRST" ; affx:hasCds [affx:startsAt "34378824" ; affx:stopsAt "34381144" ]; affx:hasExon [ affx:relatesToExon :Nap1_e1; affx:cdsType "Partial" ; affx:cdsStart "34378824" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Nap1_e2; affx:cdsType "Partial" ; affx:cdsStop "34381144" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Nap1_e3; affx:cdsType "None" ] ; . :Nap1_e1 a affx:Exon ; affx:startsAt "34378234" ; affx:stopsAt "34379498" ; affx:commonToAll "1" . :Nap1_e2 a affx:Exon ; affx:startsAt "34380966" ; affx:stopsAt "34381260" ; affx:commonToAll "1" . :Nap1_e3 a affx:Exon ; affx:startsAt "34382379" ; affx:stopsAt "34382577" ; affx:commonToAll "1" . :Gene5410 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi12805274] . :gi12805274 a affx:Transcript ; affx:unigene "iMm.14747" ; affx:translatesTo "MSHNSQAFLSTNAGLPPSYETIKEEYGVTELGEPSNSAVVRTTVINMPREVSVPDHVVWSLFNTLFFNACCLGFVAYAYSVKSRDRKMVGDVVGAQAYASTAKCLNISSLIFSILMVIICIIIFSTTSVVVFQSFAQRTPHSGF" ; affx:hasCds [affx:startsAt "131207638" ; affx:stopsAt "131208569" ]; affx:hasExon [ affx:relatesToExon :Gene5410_e1; affx:cdsType "Partial" ; affx:cdsStart "131207638" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5410_e2; affx:cdsType "Partial" ; affx:cdsStop "131208569" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "57" ; affx:stopsAt "79" ; affx:spannedBy [ affx:startsAt "131208332" ; affx:stopsAt "131208398" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "110" ; affx:stopsAt "132" ; affx:spannedBy [ affx:startsAt "131207677" ; affx:stopsAt "131207743" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene5410_e1 a affx:Exon ; affx:startsAt "131207492" ; affx:stopsAt "131207827" ; affx:commonToAll "1" . :Gene5410_e2 a affx:Exon ; affx:startsAt "131208323" ; affx:stopsAt "131208615" ; affx:commonToAll "1" . :V3R4 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13507701] . :gi13507701 a affx:Transcript ; affx:unigene "iMm.160379" ; affx:translatesTo "MEMLALQILLLCHVVVGTVGNILLFVHNFSPILTDSRLKPIQVILINLAVANAFMLLLFAYSYDLTDIVPRKPPTDLKCKLAYFFHMVARGTIMCSTCILSTYQFVTLVPGTWARVMFREISPKVVSYCCCICWLFSVLNNAYIPMNVSGPQKSHNDSDSKGNSICSISGVSVDMNILRFSHDIIFLSIMAWTSVSMVIHLHRHHQRMNHIHKANQNNRGHAETRAAHTILMLVVTFVSLYILNCITILFHISFVESRLWLRYATKLLALSFPTISPFLLIFRDRKGHCSLHIIVVWEST" ; affx:hasCds [affx:startsAt "4770621" ; affx:stopsAt "4771525" ]; affx:hasExon [ affx:relatesToExon :V3R4_e1; affx:cdsType "Partial" ; affx:cdsStart "4770621" ; affx:cdsStop "4770639" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :V3R4_e2; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "20" ; affx:spannedBy [ affx:startsAt "4771465" ; affx:stopsAt "4771525" ; affx:inFrame "2" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "41" ; affx:stopsAt "63" ; affx:spannedBy [ affx:startsAt "4771336" ; affx:stopsAt "4771402" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "125" ; affx:stopsAt "144" ; affx:spannedBy [ affx:startsAt "4771093" ; affx:stopsAt "4771150" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "184" ; affx:stopsAt "201" ; affx:spannedBy [ affx:startsAt "4770922" ; affx:stopsAt "4770973" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "228" ; affx:stopsAt "250" ; affx:spannedBy [ affx:startsAt "4770775" ; affx:stopsAt "4770841" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "260" ; affx:stopsAt "282" ; affx:spannedBy [ affx:startsAt "4770679" ; affx:stopsAt "4770745" ; affx:inFrame "2" ] ; ] ; ] ; . :V3R4_e1 a affx:Exon ; affx:startsAt "4769181" ; affx:stopsAt "4771720" ; affx:commonToAll "1" . :V3R4_e2 a affx:Exon ; affx:startsAt "4773297" ; affx:stopsAt "4773442" ; affx:commonToAll "1" . :Gene5412 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi12232058] . :gi12232058 a affx:Transcript ; affx:unigene "iMm.160382" ; affx:translatesTo "MEMLALQILLLCHVVVGTVGNILLFVHNFSQILTDSRLRPIQVILINLAVANAFMLLLFAYSYDLTDIVPRKPPTDLKCKLAYFFHLVARGTIMCSTCVLSTYQFVTLVPGTWARVMFSEISPKVVSYCCYSCWLFSVLNNAYMLMNVSGPQKSHNDSDSKGNSICSISGVSVDMNFLRFSHDIIFLSIMAWTSVSMVIHLNRHHQRMNHIHKVNQNNRGHAETRAAHTILMLVVTFVSSYTLNCISISFHISFVESCLWLRYVTKLLALSFPTISPLLLIFRDCKGHCSLRIMSVWKSI" ; affx:hasCds [affx:startsAt "5172253" ; affx:stopsAt "5173157" ]; affx:hasExon [ affx:relatesToExon :Gene5412_e1; affx:cdsType "Partial" ; affx:cdsStart "5172253" ; affx:cdsStop "5172786" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5412_e2; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "20" ; affx:spannedBy [ affx:startsAt "5173097" ; affx:stopsAt "5173157" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "6" ; affx:containsMotif [ affx:startsAt "39" ; affx:stopsAt "61" ; affx:spannedBy [ affx:startsAt "5172974" ; affx:stopsAt "5173040" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "81" ; affx:stopsAt "103" ; affx:spannedBy [ affx:startsAt "5172848" ; affx:stopsAt "5172914" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "124" ; affx:stopsAt "146" ; affx:spannedBy [ affx:startsAt "5172718" ; affx:stopsAt "5172784" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "184" ; affx:stopsAt "201" ; affx:spannedBy [ affx:startsAt "5172553" ; affx:stopsAt "5172604" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "228" ; affx:stopsAt "250" ; affx:spannedBy [ affx:startsAt "5172406" ; affx:stopsAt "5172472" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "260" ; affx:stopsAt "282" ; affx:spannedBy [ affx:startsAt "5172310" ; affx:stopsAt "5172376" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene5412_e1 a affx:Exon ; affx:startsAt "5171869" ; affx:stopsAt "5173897" ; affx:commonToAll "1" . :Gene5412_e2 a affx:Exon ; affx:startsAt "5174827" ; affx:stopsAt "5174972" ; affx:commonToAll "1" . :BC004018 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13385437] . :gi13385437 a affx:Transcript ; affx:unigene "iMm.183264" ; affx:translatesTo "MAPGPFSSGLFSPPPAALPFLLLLWAGASRGQPCPGRCICQNVAPTLTMLCAKTGLLFVPPAIDRRVVELRLTDNFIAAVRRRDFANMTSLVHLTLSRNTIGQVAAGAFADLRALRALHLDSNRLAEVRGDQLRGLGNLRHLILGNNQIRKVESAAFDAFLSTVEDLDLSYNNLEALPWEAVGQMVNLNTLTLDHNLIDHIAEGTFVQLHKLVRLDMTSNRLHKLPPDGLFLRSQGGGPKPPTPLTVSFGGNPLHCNCELLWLRRLTREDDLETCATPEHLTDRYFWSIPEEEFLCEPPLITRQAGGRALVVEGQAVSLRCRAVGDPEPVVHWVAPDGRLLGNSSRTRVRGDGTLDVTITTLRDSGTFTCIASNAAGEATAPVEVCVVPLPLMAPPPAAPPPLTEPGSSDIATPGRPGANDSTSERRLVAAELTSSSVLIRWPAQRPVPGIRMYQVQYNSSADDSLVYSSSCPGTHYVDQDGLEIRVPLASA" ; affx:hasCds [affx:startsAt "20724184" ; affx:stopsAt "20727424" ]; affx:hasExon [ affx:relatesToExon :BC004018_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :BC004018_e2; affx:cdsType "Partial" ; affx:cdsStart "20724184" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :BC004018_e3; affx:cdsType "Partial" ; affx:cdsStop "20727424" ; affx:frame "2"] ; . :BC004018_e1 a affx:Exon ; affx:startsAt "20723483" ; affx:stopsAt "20723540" ; affx:commonToAll "1" . :BC004018_e2 a affx:Exon ; affx:startsAt "20724153" ; affx:stopsAt "20725590" ; affx:commonToAll "1" . :BC004018_e3 a affx:Exon ; affx:startsAt "20727351" ; affx:stopsAt "20727489" ; affx:commonToAll "1" . :Mesdc1 a affx:Gene ; affx:strand "-" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13507647] . :gi13507647 a affx:Transcript ; affx:unigene "iMm.41654" ; affx:translatesTo "MASGSAGKPTGEAASPAPGSAVGGASSQPRKRLVSICDHCKGKMQLVADLLLLSSEARPVLFEGPASPGAGAESFEQCRDTIIARTKGLSILTHDVQSQLNMGRFGEAGDSLVELGDLVVSLTECSAHAAYLAAVATPGAQPAQPGLVDRYRVTRCRHEVEQGCAVLRATPLADMTPQLLLEVSQGLSRNLKFLTDACALASDKSRDRFSREQFKLGVKCMSTSASALLACVREVKAAPSELARSRCALFSGPLVQAVSALVGFATEPQFLGRAAAVSTEGKAVQTAILGGAMSVVSACVLLTQCLRDLAQHPDGSAKMSDHRERLRNSACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN" ; affx:hasCds [affx:startsAt "73593053" ; affx:stopsAt "73594142" ]; affx:hasExon [ affx:relatesToExon :Mesdc1_e1; affx:cdsType "Partial" ; affx:cdsStart "73593053" ; affx:cdsStop "73594142" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Mesdc1_e2; affx:cdsType "None" ] ; . :Mesdc1_e1 a affx:Exon ; affx:startsAt "73591969" ; affx:stopsAt "73594775" ; affx:commonToAll "1" . :Mesdc1_e2 a affx:Exon ; affx:startsAt "73594875" ; affx:stopsAt "73595327" ; affx:commonToAll "1" . :Gene5415 a affx:Gene ; affx:strand "+" ; affx:chr "chr7" ; affx:hasVariant [affx:representedBy :gi13542875] ; affx:hasVariant [affx:representedBy :gi18606136] . :gi13542875 a affx:Transcript ; affx:unigene "iMm.34315" ; affx:translatesTo "MTEEQKEHEAMKLVNMFDKLSRHRVIQPMGMSPRGHLTSLQDAMCETMEGQLSSDPDSDPD" ; affx:hasCds [affx:startsAt "1311