# Test data in notation3 http://www.w3.org/DesignIssues/Notation3.html # @prefix affx: . @prefix rdfs: . @prefix owl: . @prefix : <#> . affx:Gene a owl:Class ; owl:hasProperty affx:onStrand ; owl:hasProperty affx:onChr ; owl:hasProperty affx:hasVariant . affx:onStrand a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The strand on which the gene exists" . affx:onChr a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The chromosome on which the gene exists" . affx:hasVariant a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range affx:SpliceVariant ; owl:minCardinality "1" ; rdfs:comment "For associating variants to genes" . affx:SpliceVariant a owl:Class ; owl:hasProperty affx:representedBy . affx:representedBy a owl:ObjectProperty ; owl:domain affx:SpliceVariant ; owl:range affx:Transcript ; owl:minCardinality "1" ; rdfs:comment "In this data, each splice variant is represented by one transcript" . affx:Transcript a owl:Class ; owl:hasProperty affx:unigene ; owl:hasProperty affx:translatesTo ; owl:hasProperty affx:fullCds ; owl:hasProperty affx:hasExon ; owl:hasProperty affx:signalPHit ; owl:hasProperty affx:tmHMMHit ; rdfs:comment "A transcript has a CDS region, a protein translation, and exons" ; rdfs:comment "Additionally the transcript might have one or more annotations" . affx:unigene a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The Unigene ID of the transcript - and splice variant" . affx:translatesTo a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The amino acid sequence derived from the transcript" . affx:fullCds a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:GenomicCoordinates ; owl:cardinality "1" ; rdfs:comment "Start and stop coordinates of the full CDS region" . affx:hasExon a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:ExonPlusCds ; owl:minCardinality "1" ; rdfs:comment "Here, exons are defined only by their coordinates " . affx:ExonPlusCds a owl:Class ; owl:hasProperty affx:relatesToExon ; owl:hasProperty affx:cdsType ; owl:hasProperty affx:cdsStart ; owl:hasProperty affx:cdsStop ; owl:hasProperty affx:frame . affx:relatesToExon a owl:ObjectProperty ; owl:domain affx:ExonWithCds ; owl:range affx:Exon ; owl:cardinality "1" ; rdfs:comment "For associating exons with properties such as frame" . affx:Exon a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:commonToAll ; rdfs:comment "Defines the coordinates of an exon on the genome" . affx:GenomicSpan a owl:Class ; rdfs:subClassOf affx:GenomicCoordinates ; rdfs:comment "This defines a region of _ungapped_ genomic alignment" . affx:GenomicCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Start and stop, possibly with intervening gaps " ; rdfs:comment "Strand and chr will be specified at the gene level " . affx:Coordinates a owl:Class ; owl:hasProperty affx:startsAt ; owl:hasProperty affx:stopsAt . affx:startsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:stopsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:cdsType a owl:ObjectProperty ; owl:domain affx:ExonPlusCds ; owl:range rdfs:Literal ; rdfs:comment "Expected CDS types are Full, Partial, and None" . affx:commonToAll a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Shows if all the gene's variants share this object" . affx:CdsOccupancy a owl:Class ; rdfs:subClassOf rdfs:Literal . affx:cdsStart a owl:ObjectProperty ; rdfs:subClassOf affx:startsAt ; rdfs:comment "For indicating where a specific CDS region starts" . affx:cdsStop a owl:ObjectProperty ; rdfs:subClassOf affx:stopsAt ; rdfs:comment "For indicating where a specific CDS region stops" . affx:frame a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" . affx:signalPHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:SignalPeptide ; owl:cardinality "1" . affx:SignalPeptide a owl:Class ; rdfs:subClassOf affx:Annotation ; rdfs:comment "Represents a SIGNALP hit" . affx:tmHMMHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:Transmembrane ; owl:cardinality "1" . affx:Transmembrane a owl:Class ; rdfs:subClassOf affx:Annotation ; owl:hasProperty affx:helixCount ; rdfs:comment "Represents a TMHMM hit" . affx:Annotation a owl:Class ; owl:hasProperty affx:containsMotif; owl:hasProperty affx:commonToAll ; owl:hasProperty affx:motifCount . affx:containsMotif a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range affx:Motif ; owl:minCardinality "1" . affx:motifCount a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Number of motifs (eg. TM passes) in this annotation" . affx:Motif a owl:Class ; owl:hasProperty affx:hasProteinSpan . affx:hasProteinSpan a owl:ObjectProperty ; owl:domain affx:Motif ; owl:range affx:ProteinSpan . affx:ProteinCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Coordinates onto the protein sequence, possibly gapped ". affx:spannedBy a owl:ObjectProperty ; owl:domain affx:ProteinSpan ; owl:range affx:CdsSpan ; owl:minCardinality "1" . affx:ProteinSpan a owl:Class ; rdfs:subClassOf affx:ProteinCoordinates ; owl:hasProperty affx:spannedBy ; rdfs:comment "An ungapped region of the protein sequence " ; rdfs:comment "Each ProteinSpan as one or more corresponding CDS span" . affx:CdsSpan a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:inFrame ; rdfs:comment "A CDS span is a genomic span with a translation frame" ; rdfs:comment "Each CDS span describes a part of the full CDS region" . :Il6 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13624310] . :gi13624310 a affx:Transcript ; affx:unigene "iMm.1019" ; affx:translatesTo "MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT" ; affx:hasCds [affx:startsAt "28513529" ; affx:stopsAt "28519890" ]; affx:hasExon [ affx:relatesToExon :Il6_e1; affx:cdsType "Partial" ; affx:cdsStart "28513529" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Il6_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Il6_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Il6_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Il6_e5; affx:cdsType "Partial" ; affx:cdsStop "28519890" ; affx:frame "1"] ; . :Il6_e1 a affx:Exon ; affx:startsAt "28513498" ; affx:stopsAt "28513548" ; affx:commonToAll "1" . :Il6_e2 a affx:Exon ; affx:startsAt "28513713" ; affx:stopsAt "28513898" ; affx:commonToAll "1" . :Il6_e3 a affx:Exon ; affx:startsAt "28515170" ; affx:stopsAt "28515284" ; affx:commonToAll "1" . :Il6_e4 a affx:Exon ; affx:startsAt "28518346" ; affx:stopsAt "28518496" ; affx:commonToAll "1" . :Il6_e5 a affx:Exon ; affx:startsAt "28519722" ; affx:stopsAt "28520310" ; affx:commonToAll "1" . :lunatic-fringe a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi2454569] . :gi2454569 a affx:Transcript ; affx:unigene "iMm.12834" ; affx:translatesTo "MLQRCGRRLLLALVGALLACLLVLTADPPPTPMPAERGRRALRSLAGSSGGAPASGSRAAVDPGVLTREVHSLSEYFSLLTRARRDADPPPGVASRQGDGHPRPPAEVLSPRDVFIAVKTTRKFHRARLDLLFETWISRHKEMTFIFTDGEDEALAKLTGNVVLTNCSSAHSRQALSCKMAVEYDRFIESGKKWFCHVDDDNYVNLRALLRLLASYPHTQDVYIGKPSLDRPIQATERISEHKVRPVHFWFATGGAGFCISRGLALKMGPWASGGHFMSTAERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTTELHEQVTLSYGMFENKRNAVHIKGPFSVEADPSRFRSVHCHLYPDTPWCPRSAIF" ; affx:hasCds [affx:startsAt "139509034" ; affx:stopsAt "139516092" ]; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e1; affx:cdsType "Partial" ; affx:cdsStart "139509034" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e8; affx:cdsType "Partial" ; affx:cdsStop "139516092" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "26" ; affx:spannedBy [ affx:startsAt "139509034" ; affx:stopsAt "139509112" ; affx:inFrame "0" ] ; ] ; ] ; . :lunatic-fringe_e1 a affx:Exon ; affx:startsAt "139508980" ; affx:stopsAt "139509463" ; affx:commonToAll "1" . :lunatic-fringe_e2 a affx:Exon ; affx:startsAt "139513468" ; affx:stopsAt "139513517" ; affx:commonToAll "1" . :lunatic-fringe_e3 a affx:Exon ; affx:startsAt "139513909" ; affx:stopsAt "139514009" ; affx:commonToAll "1" . :lunatic-fringe_e4 a affx:Exon ; affx:startsAt "139514121" ; affx:stopsAt "139514275" ; affx:commonToAll "1" . :lunatic-fringe_e5 a affx:Exon ; affx:startsAt "139514378" ; affx:stopsAt "139514464" ; affx:commonToAll "1" . :lunatic-fringe_e6 a affx:Exon ; affx:startsAt "139514774" ; affx:stopsAt "139514940" ; affx:commonToAll "1" . :lunatic-fringe_e7 a affx:Exon ; affx:startsAt "139515809" ; affx:stopsAt "139515895" ; affx:commonToAll "1" . :lunatic-fringe_e8 a affx:Exon ; affx:startsAt "139516025" ; affx:stopsAt "139516105" ; affx:commonToAll "1" . :Lhx5 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi1388182] . :gi1388182 a affx:Transcript ; affx:unigene "iMm.5151" ; affx:translatesTo "MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHGADNPRFTDMISHPDTPSPEPGLPGALHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW" ; affx:hasCds [affx:startsAt "118487751" ; affx:stopsAt "118496438" ]; affx:hasExon [ affx:relatesToExon :Lhx5_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Lhx5_e2; affx:cdsType "Partial" ; affx:cdsStart "118487751" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e6; affx:cdsType "Partial" ; affx:cdsStop "118496438" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e7; affx:cdsType "None" ] ; . :Lhx5_e1 a affx:Exon ; affx:startsAt "118487149" ; affx:stopsAt "118487308" ; affx:commonToAll "1" . :Lhx5_e2 a affx:Exon ; affx:startsAt "118487408" ; affx:stopsAt "118487924" ; affx:commonToAll "1" . :Lhx5_e3 a affx:Exon ; affx:startsAt "118490261" ; affx:stopsAt "118490485" ; affx:commonToAll "1" . :Lhx5_e4 a affx:Exon ; affx:startsAt "118491121" ; affx:stopsAt "118491399" ; affx:commonToAll "1" . :Lhx5_e5 a affx:Exon ; affx:startsAt "118492078" ; affx:stopsAt "118492244" ; affx:commonToAll "1" . :Lhx5_e6 a affx:Exon ; affx:startsAt "118496070" ; affx:stopsAt "118497335" ; affx:commonToAll "1" . :Lhx5_e7 a affx:Exon ; affx:startsAt "118497494" ; affx:stopsAt "118497508" ; affx:commonToAll "1" . :Gene4893 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi199100] . :gi199100 a affx:Transcript ; affx:unigene "iMm.6404" ; affx:translatesTo "MEFEENLKGRADKNFSKMGKKSKKEKKEKKPAVGVFGMFRYADWLDKLCMILGTLAAIIHGTLLPLLMLVFGNMTDSFTKAEASILPSITNQSGPNSTLIISNSSLEEEMAIYAYYYTGIGAGVLIVAYIQVSLWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINDGIGDKIGMFFQSITTFLAGFIIGFISGWKLTLVILAVSPLIGLSSALWAKVLTSFTNKELQAYAKAGAVAEEVLAAIRTVIAFGGQQKELERYNKNLEEAKNVGIKKAITASISIGIAYLLVYASYALAFWYGTSLVLSNEYSIGEVLTVFFSILLGTFSIGHLAPNIEAFANARGAAFEIFKIIDNEPSIDSFSTKGYKPDSIMGNLEFKNVHFNYPSRSEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTRGNEIEPGNNAYGSQSDTDASELTSEESKSPLIRRSIYRSVHRKQDQERRLSMKEAVDEDVPLVSFWRILNLNLSEWPYLLVGVLCAVINGCIQPVFAIVFSRIVGVFSRDDDHETKRQNCNLFSLFFLVMGLISFVTYFFQGFTFGKAGEILTKRVRYMVFKSMLRQDISWFDDHKNSTGSLTTRLASDASSVKGAMGARLAVVTQNVANLGTGVILSLVYGWQLTLLLVVIIPLIVLGGIIEMKLLSGQALKDKKQLEISGKIATEAIENFRTIVSLTREQKFETMYAQSLQVPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAQQLMTFENVMLVFSAVVFGAMAAGNTSSFAPDYAKAKVSASHIIRIIEKTPEIDSYSTEGLKPTLLEGNVKFNGVQFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRAVSHEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMVQAGAKRS" ; affx:hasCds [affx:startsAt "5001909" ; affx:stopsAt "5069177" ]; affx:hasExon [ affx:relatesToExon :Gene4893_e1; affx:cdsType "Partial" ; affx:cdsStart "5001909" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e19; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e21; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e22; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e23; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e24; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e25; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e26; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e27; affx:cdsType "Partial" ; affx:cdsStop "5069177" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e28; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "8" ; affx:containsMotif [ affx:startsAt "48" ; affx:stopsAt "70" ; affx:spannedBy [ affx:startsAt "5061815" ; affx:stopsAt "5061881" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "115" ; affx:stopsAt "137" ; affx:spannedBy [ affx:startsAt "5055188" ; affx:stopsAt "5055254" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "189" ; affx:stopsAt "211" ; affx:spannedBy [ affx:startsAt "5054239" ; affx:stopsAt "5054305" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "294" ; affx:stopsAt "316" ; affx:spannedBy [ affx:startsAt "5046523" ; affx:stopsAt "5046589" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "708" ; affx:stopsAt "730" ; affx:spannedBy [ affx:startsAt "5040083" ; affx:stopsAt "5040149" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "751" ; affx:stopsAt "773" ; affx:spannedBy [ affx:startsAt "5038987" ; affx:stopsAt "5039047" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "5035718" ; affx:stopsAt "5035724" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "850" ; affx:stopsAt "872" ; affx:spannedBy [ affx:startsAt "5030186" ; affx:stopsAt "5030252" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "935" ; affx:stopsAt "957" ; affx:spannedBy [ affx:startsAt "5018312" ; affx:stopsAt "5018378" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4893_e1 a affx:Exon ; affx:startsAt "5001551" ; affx:stopsAt "5002110" ; affx:commonToAll "1" . :Gene4893_e2 a affx:Exon ; affx:startsAt "5003598" ; affx:stopsAt "5003745" ; affx:commonToAll "1" . :Gene4893_e3 a affx:Exon ; affx:startsAt "5006229" ; affx:stopsAt "5006436" ; affx:commonToAll "1" . :Gene4893_e4 a affx:Exon ; affx:startsAt "5014288" ; affx:stopsAt "5014486" ; affx:commonToAll "1" . :Gene4893_e5 a affx:Exon ; affx:startsAt "5016301" ; affx:stopsAt "5016458" ; affx:commonToAll "1" . :Gene4893_e6 a affx:Exon ; affx:startsAt "5018262" ; affx:stopsAt "5018403" ; affx:commonToAll "1" . :Gene4893_e7 a affx:Exon ; affx:startsAt "5022066" ; affx:stopsAt "5022167" ; affx:commonToAll "1" . :Gene4893_e8 a affx:Exon ; affx:startsAt "5030123" ; affx:stopsAt "5030327" ; affx:commonToAll "1" . :Gene4893_e9 a affx:Exon ; affx:startsAt "5032806" ; affx:stopsAt "5032890" ; affx:commonToAll "1" . :Gene4893_e10 a affx:Exon ; affx:startsAt "5035646" ; affx:stopsAt "5035724" ; affx:commonToAll "1" . :Gene4893_e11 a affx:Exon ; affx:startsAt "5038987" ; affx:stopsAt "5039095" ; affx:commonToAll "1" . :Gene4893_e12 a affx:Exon ; affx:startsAt "5040068" ; affx:stopsAt "5040215" ; affx:commonToAll "1" . :Gene4893_e13 a affx:Exon ; affx:startsAt "5040418" ; affx:stopsAt "5040592" ; affx:commonToAll "1" . :Gene4893_e14 a affx:Exon ; affx:startsAt "5042205" ; affx:stopsAt "5042367" ; affx:commonToAll "1" . :Gene4893_e15 a affx:Exon ; affx:startsAt "5042634" ; affx:stopsAt "5042805" ; affx:commonToAll "1" . :Gene4893_e16 a affx:Exon ; affx:startsAt "5043026" ; affx:stopsAt "5043230" ; affx:commonToAll "1" . :Gene4893_e17 a affx:Exon ; affx:startsAt "5043320" ; affx:stopsAt "5043446" ; affx:commonToAll "1" . :Gene4893_e18 a affx:Exon ; affx:startsAt "5043621" ; affx:stopsAt "5043732" ; affx:commonToAll "1" . :Gene4893_e19 a affx:Exon ; affx:startsAt "5043873" ; affx:stopsAt "5043987" ; affx:commonToAll "1" . :Gene4893_e20 a affx:Exon ; affx:startsAt "5046475" ; affx:stopsAt "5046647" ; affx:commonToAll "1" . :Gene4893_e21 a affx:Exon ; affx:startsAt "5053071" ; affx:stopsAt "5053196" ; affx:commonToAll "1" . :Gene4893_e22 a affx:Exon ; affx:startsAt "5054173" ; affx:stopsAt "5054345" ; affx:commonToAll "1" . :Gene4893_e23 a affx:Exon ; affx:startsAt "5055072" ; affx:stopsAt "5055264" ; affx:commonToAll "1" . :Gene4893_e24 a affx:Exon ; affx:startsAt "5057303" ; affx:stopsAt "5057361" ; affx:commonToAll "1" . :Gene4893_e25 a affx:Exon ; affx:startsAt "5061748" ; affx:stopsAt "5061911" ; affx:commonToAll "1" . :Gene4893_e26 a affx:Exon ; affx:startsAt "5062437" ; affx:stopsAt "5062486" ; affx:commonToAll "1" . :Gene4893_e27 a affx:Exon ; affx:startsAt "5069112" ; affx:stopsAt "5069183" ; affx:commonToAll "1" . :Gene4893_e28 a affx:Exon ; affx:startsAt "5069629" ; affx:stopsAt "5069733" ; affx:commonToAll "1" . :Gene4894 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi3869144] . :gi3869144 a affx:Transcript ; affx:unigene "iMm.20899" ; affx:translatesTo "MGRVSFSVRVSSVRRARCSCPGRCYLSCRVPPTTALRALNGLGCAGVPGETAGGAVGPGPLGTRGFLSGSKFQAPGSWKDCFGAPPAPDVLRADRSVGEGCPQKLVTANLLRFLLLVLIPCICALIVLLAILLSFVGTLKRVYFKSNDSEPLVTDGEARVPGVIPVNTVYYENTGAPSLPPSQSTPAWTPRAPSPEDQSHRNTSTCMNITHSQCQILPYHSTLAPLLPIVKNMDMEKFLKFFTYLHRLSCYQHILLFGCSLAFPECVVDGDDRHGLLPCRSFCEAAKEGCESVLGMVNSSWPDSLRCSQFRDHTETNSSVRKSCFSLQQEHGKQSLCGGGESFLCTSGLCVPKKLQCNGYNDCDDWSDEAHCNCSKDLFHCGTGKCLHYSLLCDGYDDCGDLSDEQNCDCNLTKEHRCGDGRCIAAEWVCDGDHDCVDKSDEVNCSCHSQGLVECRSGQCIPSTFQCDGDEDCKDGSDEENCSDSQTPCPEGEQGCLGSSCVESCAGSSLCDSDSSLSNCSQCEPITLELCMNLPYNHTHYPNYLGHRTQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTGQRIPPCRLLCEHSKERCESVLGIVGLQWPEDTDCNQFPEESSDNQTCLLPNEDVEECSPSHFKCRSGRCVLGSRRCDGQADCDDDSDEENCGCKERALWECPFNKQCLKHTLICDGFPDCPDSMDEKNCSFCQDNELECANHECVPRDLWCDGWVDCSDSSDEWGCVTLSKNGNSSSLLTVHKSAKEHHVCADGWRETLSQLACKQMGLGEPSVTKLIPGQEGQQWLRLYPNWENLNGSTLQELLVYRHSCPSRSEISLLCSKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGREDADVWKVVFGINNLDHPSGFMQTRFVKTILLHPRYSRAVVDYDISVVELSDDINETSYVRPVCLPSPEEYLEPDTYCYITGWGHMGNKMPFKLQEGEVRIIPLEQCQSYFDMKTITNRMICAGYESGTVDSCMGDSGGPLVCERPGGQWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVGWIERQIYIQTFLQKKSQG" ; affx:hasCds [affx:startsAt "71411403" ; affx:stopsAt "71615121" ]; affx:hasExon [ affx:relatesToExon :Gene4894_e1; affx:cdsType "Partial" ; affx:cdsStart "71411403" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e21; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e22; affx:cdsType "Partial" ; affx:cdsStop "71615121" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "113" ; affx:stopsAt "135" ; affx:spannedBy [ affx:startsAt "71582812" ; affx:stopsAt "71582878" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene4894_e1 a affx:Exon ; affx:startsAt "71409943" ; affx:stopsAt "71411598" ; affx:commonToAll "1" . :Gene4894_e2 a affx:Exon ; affx:startsAt "71412708" ; affx:stopsAt "71412842" ; affx:commonToAll "1" . :Gene4894_e3 a affx:Exon ; affx:startsAt "71414792" ; affx:stopsAt "71415064" ; affx:commonToAll "1" . :Gene4894_e4 a affx:Exon ; affx:startsAt "71425941" ; affx:stopsAt "71426116" ; affx:commonToAll "1" . :Gene4894_e5 a affx:Exon ; affx:startsAt "71426259" ; affx:stopsAt "71426309" ; affx:commonToAll "1" . :Gene4894_e6 a affx:Exon ; affx:startsAt "71429439" ; affx:stopsAt "71429553" ; affx:commonToAll "1" . :Gene4894_e7 a affx:Exon ; affx:startsAt "71439530" ; affx:stopsAt "71439660" ; affx:commonToAll "1" . :Gene4894_e8 a affx:Exon ; affx:startsAt "71440729" ; affx:stopsAt "71440840" ; affx:commonToAll "1" . :Gene4894_e9 a affx:Exon ; affx:startsAt "71442683" ; affx:stopsAt "71442797" ; affx:commonToAll "1" . :Gene4894_e10 a affx:Exon ; affx:startsAt "71448976" ; affx:stopsAt "71449084" ; affx:commonToAll "1" . :Gene4894_e11 a affx:Exon ; affx:startsAt "71449856" ; affx:stopsAt "71450002" ; affx:commonToAll "1" . :Gene4894_e12 a affx:Exon ; affx:startsAt "71452901" ; affx:stopsAt "71453133" ; affx:commonToAll "1" . :Gene4894_e13 a affx:Exon ; affx:startsAt "71463886" ; affx:stopsAt "71463994" ; affx:commonToAll "1" . :Gene4894_e14 a affx:Exon ; affx:startsAt "71466892" ; affx:stopsAt "71467009" ; affx:commonToAll "1" . :Gene4894_e15 a affx:Exon ; affx:startsAt "71468390" ; affx:stopsAt "71468501" ; affx:commonToAll "1" . :Gene4894_e16 a affx:Exon ; affx:startsAt "71470667" ; affx:stopsAt "71470775" ; affx:commonToAll "1" . :Gene4894_e17 a affx:Exon ; affx:startsAt "71482116" ; affx:stopsAt "71482230" ; affx:commonToAll "1" . :Gene4894_e18 a affx:Exon ; affx:startsAt "71532557" ; affx:stopsAt "71532742" ; affx:commonToAll "1" . :Gene4894_e19 a affx:Exon ; affx:startsAt "71545767" ; affx:stopsAt "71545975" ; affx:commonToAll "1" . :Gene4894_e20 a affx:Exon ; affx:startsAt "71564839" ; affx:stopsAt "71565040" ; affx:commonToAll "1" . :Gene4894_e21 a affx:Exon ; affx:startsAt "71582808" ; affx:stopsAt "71582950" ; affx:commonToAll "1" . :Gene4894_e22 a affx:Exon ; affx:startsAt "71614854" ; affx:stopsAt "71615181" ; affx:commonToAll "1" . :Gene4895 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15488725] . :gi15488725 a affx:Transcript ; affx:unigene "iMm.80532" ; affx:translatesTo "MEYPYTTKMLSSSLSPQNGTWSDTISLLLALGVALYLGYYWACVPQRPRLVAGPQFLAFLEQHCPVTVETFYPTLWCFEGRLQTIFRVLLQSQPVVPYRSEVLQTPDGGQFLLDWAEQPNSTHYPDPTTQPIVLLLPGISGSSQEPYILHLVNQALKDGYRAVVFNNRGCRGEELLTHRAYCASNTEDLETVVKHIKRRYSQAPLLAVGISFGGILVLNYLAQTGKAGGLVAGLTMSACWDSFETVDSLETPLNSLLFNQPLTAGLCRLVARNRKPIEKVLDVDFAIKARTIRQLDERYTSVAFGYKDCAAYYQAASPRTKVDAIHTPVLCLNAADDPFSPVHAFPLQAAQKSPYVALLITARGGHIGFLEGLMPWQHCYMNRVLHQYARAIFQHSVGLPDLGVLTPEDGKS" ; affx:hasCds [affx:startsAt "29611715" ; affx:stopsAt "29616629" ]; affx:hasExon [ affx:relatesToExon :Gene4895_e1; affx:cdsType "Partial" ; affx:cdsStart "29611715" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e6; affx:cdsType "Partial" ; affx:cdsStop "29615761" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e9; affx:cdsType "Partial" ; affx:cdsStop "29616629" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "20" ; affx:stopsAt "42" ; affx:spannedBy [ affx:startsAt "29611775" ; affx:stopsAt "29611841" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4895_e1 a affx:Exon ; affx:startsAt "29611710" ; affx:stopsAt "29611853" ; affx:commonToAll "1" . :Gene4895_e2 a affx:Exon ; affx:startsAt "29614489" ; affx:stopsAt "29614650" ; affx:commonToAll "1" . :Gene4895_e3 a affx:Exon ; affx:startsAt "29614947" ; affx:stopsAt "29615130" ; affx:commonToAll "1" . :Gene4895_e4 a affx:Exon ; affx:startsAt "29615271" ; affx:stopsAt "29615317" ; affx:commonToAll "1" . :Gene4895_e5 a affx:Exon ; affx:startsAt "29615483" ; affx:stopsAt "29615596" ; affx:commonToAll "1" . :Gene4895_e6 a affx:Exon ; affx:startsAt "29615695" ; affx:stopsAt "29615870" ; affx:commonToAll "1" . :Gene4895_e7 a affx:Exon ; affx:startsAt "29616009" ; affx:stopsAt "29616058" ; affx:commonToAll "1" . :Gene4895_e8 a affx:Exon ; affx:startsAt "29616138" ; affx:stopsAt "29616304" ; affx:commonToAll "1" . :Gene4895_e9 a affx:Exon ; affx:startsAt "29616420" ; affx:stopsAt "29616696" ; affx:commonToAll "1" . :Gene4896 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi3149958] . :gi3149958 a affx:Transcript ; affx:unigene "iMm.10080" ; affx:translatesTo "MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQLELRARYNLSEGGYEELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIGFVSCISTLCIGAAAFSYYERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNLVVLRFMTMNAEDEKRDAEHRALLTHNGQAVGLGGLSCLSGSLGDGVRPRDPVTCAAAAGGVGVGVGGSGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEHSHSSPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLAAFRGLMKRRSSV" ; affx:hasCds [affx:startsAt "29246866" ; affx:stopsAt "29282253" ]; affx:hasExon [ affx:relatesToExon :Gene4896_e1; affx:cdsType "Partial" ; affx:cdsStart "29246866" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4896_e2; affx:cdsType "Partial" ; affx:cdsStop "29282253" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "23" ; affx:spannedBy [ affx:startsAt "29246866" ; affx:stopsAt "29246935" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "75" ; affx:stopsAt "97" ; affx:spannedBy [ affx:startsAt "29247091" ; affx:stopsAt "29247149" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "29281306" ; affx:stopsAt "29281314" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "109" ; affx:stopsAt "128" ; affx:spannedBy [ affx:startsAt "29281350" ; affx:stopsAt "29281407" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "159" ; affx:stopsAt "181" ; affx:spannedBy [ affx:startsAt "29281500" ; affx:stopsAt "29281566" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "186" ; affx:stopsAt "208" ; affx:spannedBy [ affx:startsAt "29281581" ; affx:stopsAt "29281647" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "221" ; affx:stopsAt "243" ; affx:spannedBy [ affx:startsAt "29281686" ; affx:stopsAt "29281752" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4896_e1 a affx:Exon ; affx:startsAt "29246731" ; affx:stopsAt "29247149" ; affx:commonToAll "1" . :Gene4896_e2 a affx:Exon ; affx:startsAt "29281306" ; affx:stopsAt "29282897" ; affx:commonToAll "1" . :Gene4897 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi3387819] . :gi3387819 a affx:Transcript ; affx:unigene "iMm.200775" ; affx:translatesTo "MAVTSHHMVPVFVLMSACLATAGPEPSTRCELSPISASHPVQALMESFTVLSGCASRGTTGLPREVHILNLRSTDQGLGQPQREVTLHLNPIASVHTHHKPVVFLLNSPQPLVWHVKTERLAAGVPRLFLVSEGSVVQFSSGNFSLTAETEERSFPQENEHLLHWAQKEYGAVTSFTELKIARNIYIKVGEDQVFPPTCNIGKNFLSLNYLAEYLQPKAAEGCVLASQPHEKEVHIIELISPNSNPYSTFQVDIIIDIRPAREDPEVVKNLVLILKCKKSVNWVIKSFDVKGNLKVIAPDSIGFGKESERSMTVTKLVRNDIPSTQENLMKWALDNGYSPVTSYTIAPVANRFHLRLENNEEMRDEEVHTIPPELRILLGPDHLPALDSPSFQGEIPNGGFPFPFPDIPRRGWKEGEDRIPRPKEPIIPRVQLLPDHREPEEVQGGVNIALSVKCDNEKMVVAVDKDSFQTNGYSGMELTLLDPSCKAKMNGTHFVLESPLNGCGTRHRRSAPDGVVYYNSIVVQAPSPGDSSGWPDGYEDLESGDNGFPGDTDEGETAPLSRAGVVVFNCSLRQLRSPSGFQDQLDGNATFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFISPYSNPDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFVFKSVFNTSLLFLHCELTLCSRKKGSQKLPKCVTPDDACTSLDATMIWTMMQNKKTFTKPLAVVLQVDYKENVPNMKESSPVPPPPQIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETARRQQVPTSPPASENSSAAHSIGSTQSTPCSSSSTA" ; affx:hasCds [affx:startsAt "104777216" ; affx:stopsAt "104940056" ]; affx:hasExon [ affx:relatesToExon :Gene4897_e1; affx:cdsType "Partial" ; affx:cdsStart "104777216" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e16; affx:cdsType "Partial" ; affx:cdsStop "104940056" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "22" ; affx:spannedBy [ affx:startsAt "104939990" ; affx:stopsAt "104940056" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "786" ; affx:stopsAt "808" ; affx:spannedBy [ affx:startsAt "104785887" ; affx:stopsAt "104785953" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4897_e1 a affx:Exon ; affx:startsAt "104776043" ; affx:stopsAt "104777335" ; affx:commonToAll "1" . :Gene4897_e2 a affx:Exon ; affx:startsAt "104785877" ; affx:stopsAt "104785985" ; affx:commonToAll "1" . :Gene4897_e3 a affx:Exon ; affx:startsAt "104788818" ; affx:stopsAt "104788866" ; affx:commonToAll "1" . :Gene4897_e4 a affx:Exon ; affx:startsAt "104797944" ; affx:stopsAt "104798062" ; affx:commonToAll "1" . :Gene4897_e5 a affx:Exon ; affx:startsAt "104800216" ; affx:stopsAt "104800513" ; affx:commonToAll "1" . :Gene4897_e6 a affx:Exon ; affx:startsAt "104804401" ; affx:stopsAt "104804560" ; affx:commonToAll "1" . :Gene4897_e7 a affx:Exon ; affx:startsAt "104805012" ; affx:stopsAt "104805153" ; affx:commonToAll "1" . :Gene4897_e8 a affx:Exon ; affx:startsAt "104807251" ; affx:stopsAt "104807404" ; affx:commonToAll "1" . :Gene4897_e9 a affx:Exon ; affx:startsAt "104807866" ; affx:stopsAt "104808195" ; affx:commonToAll "1" . :Gene4897_e10 a affx:Exon ; affx:startsAt "104809839" ; affx:stopsAt "104810029" ; affx:commonToAll "1" . :Gene4897_e11 a affx:Exon ; affx:startsAt "104815387" ; affx:stopsAt "104815535" ; affx:commonToAll "1" . :Gene4897_e12 a affx:Exon ; affx:startsAt "104817622" ; affx:stopsAt "104817791" ; affx:commonToAll "1" . :Gene4897_e13 a affx:Exon ; affx:startsAt "104822084" ; affx:stopsAt "104822268" ; affx:commonToAll "1" . :Gene4897_e14 a affx:Exon ; affx:startsAt "104850004" ; affx:stopsAt "104850142" ; affx:commonToAll "1" . :Gene4897_e15 a affx:Exon ; affx:startsAt "104888284" ; affx:stopsAt "104888469" ; affx:commonToAll "1" . :Gene4897_e16 a affx:Exon ; affx:startsAt "104939989" ; affx:stopsAt "104940148" ; affx:commonToAll "1" . :HCG-1 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi4105255] . :gi4105255 a affx:Transcript ; affx:unigene "iMm.21846" ; affx:translatesTo "MSSHVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNTCRTVASTSVGLNHS" ; affx:hasCds [affx:startsAt "147459861" ; affx:stopsAt "147506582" ]; affx:hasExon [ affx:relatesToExon :HCG-1_e1; affx:cdsType "Partial" ; affx:cdsStart "147459861" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HCG-1_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HCG-1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HCG-1_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HCG-1_e5; affx:cdsType "Partial" ; affx:cdsStop "147506582" ; affx:frame "2"] ; . :HCG-1_e1 a affx:Exon ; affx:startsAt "147458892" ; affx:stopsAt "147459910" ; affx:commonToAll "1" . :HCG-1_e2 a affx:Exon ; affx:startsAt "147460295" ; affx:stopsAt "147460365" ; affx:commonToAll "1" . :HCG-1_e3 a affx:Exon ; affx:startsAt "147463110" ; affx:stopsAt "147463197" ; affx:commonToAll "1" . :HCG-1_e4 a affx:Exon ; affx:startsAt "147465735" ; affx:stopsAt "147465844" ; affx:commonToAll "1" . :HCG-1_e5 a affx:Exon ; affx:startsAt "147506555" ; affx:stopsAt "147506631" ; affx:commonToAll "1" . :Gene4899 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi2661089] . :gi2661089 a affx:Transcript ; affx:unigene "iMm.6259" ; affx:translatesTo "MRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQILLEKKMLGEDSDEEEEANTTEGKSSRSGQDDELGCTWGMGEDAVEDEAEENPIALDFQQDREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKKKEAMVQCSLEACRVLDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLVEKKRLNRMKKAGKLDEKPETFESLVAKLNDAERELAEISERLKASSKVLSEPSSQDSLDAFMSEMKSGSTLDGVSRKKLHLRTFELRKEQQRLKGLIKLVKPAEIPELKKTELQTTNAENKTKKLALPLFGAMKGGSKFKLKTGTVGKLPPKRPELPPALMQMKDEPEVEEEEEEEEEEEEKVKEEHEERVEDGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHAAPANEYKQDRDEPKKKKSPGPGKFPPILSSKYPEDDPDYCIWVPPEGQSGDGRTHLNDKYGY" ; affx:hasCds [affx:startsAt "30197108" ; affx:stopsAt "30223151" ]; affx:hasExon [ affx:relatesToExon :Gene4899_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4899_e2; affx:cdsType "Partial" ; affx:cdsStart "30197108" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e14; affx:cdsType "Partial" ; affx:cdsStop "30223151" ; affx:frame "2"] ; . :Gene4899_e1 a affx:Exon ; affx:startsAt "30196485" ; affx:stopsAt "30196651" ; affx:commonToAll "1" . :Gene4899_e2 a affx:Exon ; affx:startsAt "30196773" ; affx:stopsAt "30197147" ; affx:commonToAll "1" . :Gene4899_e3 a affx:Exon ; affx:startsAt "30197505" ; affx:stopsAt "30197701" ; affx:commonToAll "1" . :Gene4899_e4 a affx:Exon ; affx:startsAt "30200143" ; affx:stopsAt "30200266" ; affx:commonToAll "1" . :Gene4899_e5 a affx:Exon ; affx:startsAt "30201483" ; affx:stopsAt "30201544" ; affx:commonToAll "1" . :Gene4899_e6 a affx:Exon ; affx:startsAt "30201954" ; affx:stopsAt "30202094" ; affx:commonToAll "1" . :Gene4899_e7 a affx:Exon ; affx:startsAt "30203555" ; affx:stopsAt "30203716" ; affx:commonToAll "1" . :Gene4899_e8 a affx:Exon ; affx:startsAt "30204368" ; affx:stopsAt "30204438" ; affx:commonToAll "1" . :Gene4899_e9 a affx:Exon ; affx:startsAt "30205648" ; affx:stopsAt "30205835" ; affx:commonToAll "1" . :Gene4899_e10 a affx:Exon ; affx:startsAt "30209896" ; affx:stopsAt "30210008" ; affx:commonToAll "1" . :Gene4899_e11 a affx:Exon ; affx:startsAt "30213180" ; affx:stopsAt "30213424" ; affx:commonToAll "1" . :Gene4899_e12 a affx:Exon ; affx:startsAt "30217973" ; affx:stopsAt "30218044" ; affx:commonToAll "1" . :Gene4899_e13 a affx:Exon ; affx:startsAt "30220075" ; affx:stopsAt "30220145" ; affx:commonToAll "1" . :Gene4899_e14 a affx:Exon ; affx:startsAt "30223101" ; affx:stopsAt "30223403" ; affx:commonToAll "1" . :oasl9 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18389328] . :gi18389328 a affx:Transcript ; affx:unigene "iMm.95479" ; affx:translatesTo "MAVAQELYGFPASKLDSFVAQWLQPTREWKEEVLETVQTVEQFLRQENFREDRGPARDVRVLKVLKVGCFGNGTVLRSTTDVELVVFLSCFHSFQEEAKHHQAVLRLIQKRMYYCQELMDLGLSNLSVTNRVPSSLIFTIQTRETWETITVTVVPAYRALGPSCPSSEVYANLIKANGYPGNFSPSFSELQRNFVKHRPTKLKSLLRLVKHWYQQYVRDKCPRANLPPLYALELLTVYAWEAGTREDANFRLDEGLATVMELLQDHELLCIYWTKHYTLQHPVIEACVRRQLRGQRPIILDPADPTNNVAEGYRWDIVAQRANQCLKQDCCYDNRDSPVPSWRVKRAPDIQVTVQEWGHSDLTFWVNPYEPIKKLKEKIQLSQGYLGLQRLSFQEPGGERQLIRSHCTLAYYGIFCDTHICLLDTISPEIQVFVKNPDGRSHAYAIHPLDYVLNLKQQIEDRQGLRCQEQRLEFQGHILEDWFDFKSYGIQDSVTVILSKTTEGAAPFVPS" ; affx:hasCds [affx:startsAt "112887506" ; affx:stopsAt "112901495" ]; affx:hasExon [ affx:relatesToExon :oasl9_e1; affx:cdsType "Partial" ; affx:cdsStart "112887506" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl9_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl9_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl9_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl9_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oasl9_e6; affx:cdsType "Partial" ; affx:cdsStop "112901495" ; affx:frame "2"] ; . :oasl9_e1 a affx:Exon ; affx:startsAt "112887500" ; affx:stopsAt "112887704" ; affx:commonToAll "1" . :oasl9_e2 a affx:Exon ; affx:startsAt "112892117" ; affx:stopsAt "112892400" ; affx:commonToAll "1" . :oasl9_e3 a affx:Exon ; affx:startsAt "112893916" ; affx:stopsAt "112894080" ; affx:commonToAll "1" . :oasl9_e4 a affx:Exon ; affx:startsAt "112896799" ; affx:stopsAt "112897041" ; affx:commonToAll "1" . :oasl9_e5 a affx:Exon ; affx:startsAt "112899997" ; affx:stopsAt "112900145" ; affx:commonToAll "1" . :oasl9_e6 a affx:Exon ; affx:startsAt "112900994" ; affx:stopsAt "112901989" ; affx:commonToAll "1" . :oasl11 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18389332] . :gi18389332 a affx:Transcript ; affx:unigene "iMm.7703" ; affx:translatesTo "MGNWLTGNWSSDRSSGYSSGWSPGGSSGVPSGPVHKLEKSIQANLTPNENCLKQIAVSSVPSQKLEGYIQENLKPNRESLKQIDQAVDAIWDLLRSQIPVKEVAKGGSYGRETALRGCSDGTLVLFMDCFQQFQDQIKYQDAYLDVIELWLKIHEKKSVKHEHALVVQVSVPGQRILLQLLPVFNPLRSNENPSSCVYVDLKKSMDQVRASPGEFSDCFTTLQQRFFKKYPQRLKDLILLVKHWYEQCQEKWKTPPPQPLLYALELLTVYAWEQGCQAEDFDMAQGVRTVLRLIQRPTELCVYWTVNYNFEDETVRNILLHQLRSQRPVILDPTDPTNNVGKDDGFWELLTEEAMAWLYSPSLNTESPAPYWDVLPMPLFVTPSHLLNKFIKDFLQPNKLFLKQIKEAVDIICSFLKNVCFLNSDTKVLKTVKGGSTAKGTALKRGSDADIVVFLSSLESYDSLKTNRSQFVQEIQKQLEEFVQAQEWEVTFEISKWKAPRVLSFTLKSKTLNESVEFDVLPAYDALGQLRSDFTLRPEAYKDLIELCASQDIKEGEFSICFTELQRNFIQTRPTKLKSLLRLIKHWYKQYERKMKPKASLPPKYALELLTVYAWEQGSGTDDFDIAEGFRTVLDLVIKYRQLCIFWTVNYNFEEEYMRKFLLTQIQKKRPVILDPADPTGDVGGGDRWCWHLLAEEAKEWLSSPCFQVEQKGLVQPWKVPVMQTPGSCGGQIYPTVGGVTK" ; affx:hasCds [affx:startsAt "118789054" ; affx:stopsAt "118806762" ]; affx:hasExon [ affx:relatesToExon :oasl11_e1; affx:cdsType "Partial" ; affx:cdsStart "118789054" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl11_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oasl11_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oasl11_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl11_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl11_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl11_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl11_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl11_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl11_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oasl11_e11; affx:cdsType "Partial" ; affx:cdsStop "118806762" ; affx:frame "2"] ; . :oasl11_e1 a affx:Exon ; affx:startsAt "118787494" ; affx:stopsAt "118789120" ; affx:commonToAll "1" . :oasl11_e2 a affx:Exon ; affx:startsAt "118790575" ; affx:stopsAt "118790729" ; affx:commonToAll "1" . :oasl11_e3 a affx:Exon ; affx:startsAt "118792141" ; affx:stopsAt "118792380" ; affx:commonToAll "1" . :oasl11_e4 a affx:Exon ; affx:startsAt "118793158" ; affx:stopsAt "118793346" ; affx:commonToAll "1" . :oasl11_e5 a affx:Exon ; affx:startsAt "118795240" ; affx:stopsAt "118795523" ; affx:commonToAll "1" . :oasl11_e6 a affx:Exon ; affx:startsAt "118795615" ; affx:stopsAt "118795789" ; affx:commonToAll "1" . :oasl11_e7 a affx:Exon ; affx:startsAt "118798140" ; affx:stopsAt "118798285" ; affx:commonToAll "1" . :oasl11_e8 a affx:Exon ; affx:startsAt "118800040" ; affx:stopsAt "118800279" ; affx:commonToAll "1" . :oasl11_e9 a affx:Exon ; affx:startsAt "118802672" ; affx:stopsAt "118802851" ; affx:commonToAll "1" . :oasl11_e10 a affx:Exon ; affx:startsAt "118805526" ; affx:stopsAt "118805773" ; affx:commonToAll "1" . :oasl11_e11 a affx:Exon ; affx:startsAt "118806447" ; affx:stopsAt "118806842" ; affx:commonToAll "1" . :Gene4902 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15281297] . :gi15281297 a affx:Transcript ; affx:unigene "iMm.41565" ; affx:translatesTo "MSKLARLEREEIMECQVMWEPDSKKDTQMDRFRAAVGTACGLALGNYNDLYHWSVRSYMDFWAEFWKFSGIVYSRMYDEVVDTSKGIADVPEWFRGSRLNYAENLLRHKENDRVALYVAREGREEIVKVTFEELRQQVALFAAAMRKMGVKKGDRVVGYLPNSAHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHGHLEKLQRVVKGLPDLQRVVLIPYVLPREKIDISKIPNSVFLDDFLASGTGAQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCMVHSAGGTLIQHLKEHMLHGNMTSSDILLYYTTVGWMMWNWMVSALATGASLVLYDGSPLVPTPNVLWDLVDRIGITILGTGAKWLSVLEEKDMKPVETHNLHTLHTILSTGSPLKAQSYEYVYRCIKSSVLLGSISGGTDIISCFMGQNSSIPVYKGEIQARNLGMAVEAWDEEGKAVWGASGELVCTKPIPCQPTHFWNDENGSKYRKAYFSKFPGVWAHGDYCRINPKTGGIIMLGRSDGTLNPNGVRFGSSEIYNIVEAFDEVEDSLCVPQYNRDGEERVVLFLKMASGHTFQPDLVKRIRDAIRLGLSARHVPSLILETRGIPYTLNGKKVEVAVKQVMAGRTVEHRGAFSNPETLDLYRDIPELQDF" ; affx:hasCds [affx:startsAt "123722546" ; affx:stopsAt "123762667" ]; affx:hasExon [ affx:relatesToExon :Gene4902_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e18; affx:cdsType "Full" ; affx:frame "2"] ; . :Gene4902_e1 a affx:Exon ; affx:startsAt "123722546" ; affx:stopsAt "123722679" ; affx:commonToAll "1" . :Gene4902_e2 a affx:Exon ; affx:startsAt "123729399" ; affx:stopsAt "123729503" ; affx:commonToAll "1" . :Gene4902_e3 a affx:Exon ; affx:startsAt "123731253" ; affx:stopsAt "123731374" ; affx:commonToAll "1" . :Gene4902_e4 a affx:Exon ; affx:startsAt "123736502" ; affx:stopsAt "123736616" ; affx:commonToAll "1" . :Gene4902_e5 a affx:Exon ; affx:startsAt "123741627" ; affx:stopsAt "123741725" ; affx:commonToAll "1" . :Gene4902_e6 a affx:Exon ; affx:startsAt "123749555" ; affx:stopsAt "123749670" ; affx:commonToAll "1" . :Gene4902_e7 a affx:Exon ; affx:startsAt "123749921" ; affx:stopsAt "123750003" ; affx:commonToAll "1" . :Gene4902_e8 a affx:Exon ; affx:startsAt "123752521" ; affx:stopsAt "123752669" ; affx:commonToAll "1" . :Gene4902_e9 a affx:Exon ; affx:startsAt "123754990" ; affx:stopsAt "123755071" ; affx:commonToAll "1" . :Gene4902_e10 a affx:Exon ; affx:startsAt "123756092" ; affx:stopsAt "123756217" ; affx:commonToAll "1" . :Gene4902_e11 a affx:Exon ; affx:startsAt "123757953" ; affx:stopsAt "123758018" ; affx:commonToAll "1" . :Gene4902_e12 a affx:Exon ; affx:startsAt "123758159" ; affx:stopsAt "123758282" ; affx:commonToAll "1" . :Gene4902_e13 a affx:Exon ; affx:startsAt "123758938" ; affx:stopsAt "123759052" ; affx:commonToAll "1" . :Gene4902_e14 a affx:Exon ; affx:startsAt "123759415" ; affx:stopsAt "123759541" ; affx:commonToAll "1" . :Gene4902_e15 a affx:Exon ; affx:startsAt "123760232" ; affx:stopsAt "123760302" ; affx:commonToAll "1" . :Gene4902_e16 a affx:Exon ; affx:startsAt "123760482" ; affx:stopsAt "123760541" ; affx:commonToAll "1" . :Gene4902_e17 a affx:Exon ; affx:startsAt "123761241" ; affx:stopsAt "123761444" ; affx:commonToAll "1" . :Gene4902_e18 a affx:Exon ; affx:startsAt "123762529" ; affx:stopsAt "123762667" ; affx:commonToAll "1" . :NLP-1 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15054481] . :gi15054481 a affx:Transcript ; affx:unigene "iMm.45513" ; affx:translatesTo "MTICQFFLQGRCRFGDRCWNEHPGARGAGGARQPPPQQQPPSGNNRRGWNASSQRYSNVIQPSSFPKSTPWGGSRDQDKPPFGSFDSGASTSRGFGSSQNPFASPLSDEQKDEKKLLEGIVKDVEVWESSGQWMFSVYSPVRKKPNISAKLCSTACKSVEE" ; affx:hasCds [affx:startsAt "22622842" ; affx:stopsAt "22635789" ]; affx:hasExon [ affx:relatesToExon :NLP-1_e1; affx:cdsType "Partial" ; affx:cdsStart "22622842" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :NLP-1_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :NLP-1_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :NLP-1_e4; affx:cdsType "Partial" ; affx:cdsStop "22635789" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :NLP-1_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :NLP-1_e6; affx:cdsType "None" ] ; . :NLP-1_e1 a affx:Exon ; affx:startsAt "22622803" ; affx:stopsAt "22622969" ; affx:commonToAll "1" . :NLP-1_e2 a affx:Exon ; affx:startsAt "22625108" ; affx:stopsAt "22625331" ; affx:commonToAll "1" . :NLP-1_e3 a affx:Exon ; affx:startsAt "22627061" ; affx:stopsAt "22627156" ; affx:commonToAll "1" . :NLP-1_e4 a affx:Exon ; affx:startsAt "22635748" ; affx:stopsAt "22635835" ; affx:commonToAll "1" . :NLP-1_e5 a affx:Exon ; affx:startsAt "22638829" ; affx:stopsAt "22638914" ; affx:commonToAll "1" . :NLP-1_e6 a affx:Exon ; affx:startsAt "22639656" ; affx:stopsAt "22640586" ; affx:commonToAll "1" . :Gene4904 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi7619895] . :gi7619895 a affx:Transcript ; affx:unigene "iMm.29430" ; affx:translatesTo "MAHVGSRKRSRSRSRSRSGRRGSEKRSKRSSKDASRNCSASRSQGHKAGSASGVEERSKHKAQRTSRSSSTSSSSSSSSSASSSSSSDGRKKRAKHKEKKRKKKKKKRKKKLKKRVKEKAVAVHQAEALPGPSLDQWHRSAGEDNDGPVLTDEQKSRIQAMKPMTKEEWDARQSVIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDGLAFQMRTGLLP" ; affx:hasCds [affx:startsAt "122217228" ; affx:stopsAt "122218824" ]; affx:hasExon [ affx:relatesToExon :Gene4904_e1; affx:cdsType "Partial" ; affx:cdsStart "122217228" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4904_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4904_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4904_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4904_e5; affx:cdsType "Partial" ; affx:cdsStop "122218824" ; affx:frame "1"] ; . :Gene4904_e1 a affx:Exon ; affx:startsAt "122216890" ; affx:stopsAt "122217394" ; affx:commonToAll "1" . :Gene4904_e2 a affx:Exon ; affx:startsAt "122217697" ; affx:stopsAt "122217976" ; affx:commonToAll "1" . :Gene4904_e3 a affx:Exon ; affx:startsAt "122218053" ; affx:stopsAt "122218171" ; affx:commonToAll "1" . :Gene4904_e4 a affx:Exon ; affx:startsAt "122218612" ; affx:stopsAt "122218682" ; affx:commonToAll "1" . :Gene4904_e5 a affx:Exon ; affx:startsAt "122218767" ; affx:stopsAt "122218978" ; affx:commonToAll "1" . :Tbx5 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi6002731] . :gi6002731 a affx:Transcript ; affx:unigene "iMm.103636" ; affx:translatesTo "MADTDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDLELHRMSRMQSKEYPVVPRSTVRHKVTSNHSPFSSETRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLAQEHSQIYHCTKRKDEECSSTEHPYKKPYMETSPSEEDTFYRSGYPQQQGLSTSYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGGLQPPEFLYTHGVPRTLSPHQYHSVHGVGMVPEWSENS" ; affx:hasCds [affx:startsAt "117883579" ; affx:stopsAt "117931364" ]; affx:hasExon [ affx:relatesToExon :Tbx5_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Tbx5_e2; affx:cdsType "Partial" ; affx:cdsStart "117883579" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e9; affx:cdsType "Partial" ; affx:cdsStop "117931364" ; affx:frame "0"] ; . :Tbx5_e1 a affx:Exon ; affx:startsAt "117881568" ; affx:stopsAt "117881943" ; affx:commonToAll "1" . :Tbx5_e2 a affx:Exon ; affx:startsAt "117883541" ; affx:stopsAt "117883726" ; affx:commonToAll "1" . :Tbx5_e3 a affx:Exon ; affx:startsAt "117885361" ; affx:stopsAt "117885456" ; affx:commonToAll "1" . :Tbx5_e4 a affx:Exon ; affx:startsAt "117887432" ; affx:stopsAt "117887552" ; affx:commonToAll "1" . :Tbx5_e5 a affx:Exon ; affx:startsAt "117888418" ; affx:stopsAt "117888566" ; affx:commonToAll "1" . :Tbx5_e6 a affx:Exon ; affx:startsAt "117891630" ; affx:stopsAt "117891783" ; affx:commonToAll "1" . :Tbx5_e7 a affx:Exon ; affx:startsAt "117900359" ; affx:stopsAt "117900451" ; affx:commonToAll "1" . :Tbx5_e8 a affx:Exon ; affx:startsAt "117918708" ; affx:stopsAt "117918935" ; affx:commonToAll "1" . :Tbx5_e9 a affx:Exon ; affx:startsAt "117930789" ; affx:stopsAt "117931379" ; affx:commonToAll "1" . :Slit2 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi5532494] . :gi5532494 a affx:Transcript ; affx:unigene "iMm.34584" ; affx:translatesTo "MSGIGWQTLSLSLGLVLSILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGAFDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPVDITIQAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGENAGFWCTCADGFEGENCEVNIDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYIGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCVCPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIIRINEPICQCLPGYLGEKCEKLVSVNFVNKESYLQIPSAKVRPQTNITLQIATDEDSGILLYKGDKDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLTLDSSLSLSVDGGSPKVITNLSKQSTLNFDSPLYVGGMPGKNNVASLRQAPGQNGTSFHGCIRNLYINSELQDFRKMPMQTGILPGCEPCHKKVCAHGMCQPSSQSGFTCECEEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQMIKCKHGKCRLSGVGQPYCECNSGFTGDSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSFVDEVEKVVKCGCARCAS" ; affx:hasCds [affx:startsAt "46981771" ; affx:stopsAt "47299849" ]; affx:hasExon [ affx:relatesToExon :Slit2_e1; affx:cdsType "Partial" ; affx:cdsStart "46981771" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e20; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e21; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e22; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e24; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e25; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e26; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e27; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e28; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e29; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e30; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e31; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e32; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e33; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e34; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e35; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e36; affx:cdsType "Partial" ; affx:cdsStop "47299849" ; affx:frame "1"] ; . :Slit2_e1 a affx:Exon ; affx:startsAt "46981524" ; affx:stopsAt "46981950" ; affx:commonToAll "1" . :Slit2_e2 a affx:Exon ; affx:startsAt "46984570" ; affx:stopsAt "46984642" ; affx:commonToAll "1" . :Slit2_e3 a affx:Exon ; affx:startsAt "46985851" ; affx:stopsAt "46985923" ; affx:commonToAll "1" . :Slit2_e4 a affx:Exon ; affx:startsAt "46997040" ; affx:stopsAt "46997112" ; affx:commonToAll "1" . :Slit2_e5 a affx:Exon ; affx:startsAt "47165679" ; affx:stopsAt "47165751" ; affx:commonToAll "1" . :Slit2_e6 a affx:Exon ; affx:startsAt "47177769" ; affx:stopsAt "47177841" ; affx:commonToAll "1" . :Slit2_e7 a affx:Exon ; affx:startsAt "47182019" ; affx:stopsAt "47182091" ; affx:commonToAll "1" . :Slit2_e8 a affx:Exon ; affx:startsAt "47184952" ; affx:stopsAt "47185116" ; affx:commonToAll "1" . :Slit2_e9 a affx:Exon ; affx:startsAt "47187716" ; affx:stopsAt "47187855" ; affx:commonToAll "1" . :Slit2_e10 a affx:Exon ; affx:startsAt "47206280" ; affx:stopsAt "47206352" ; affx:commonToAll "1" . :Slit2_e11 a affx:Exon ; affx:startsAt "47206807" ; affx:stopsAt "47206879" ; affx:commonToAll "1" . :Slit2_e12 a affx:Exon ; affx:startsAt "47212976" ; affx:stopsAt "47213048" ; affx:commonToAll "1" . :Slit2_e13 a affx:Exon ; affx:startsAt "47215186" ; affx:stopsAt "47215330" ; affx:commonToAll "1" . :Slit2_e14 a affx:Exon ; affx:startsAt "47215441" ; affx:stopsAt "47215605" ; affx:commonToAll "1" . :Slit2_e15 a affx:Exon ; affx:startsAt "47220177" ; affx:stopsAt "47220328" ; affx:commonToAll "1" . :Slit2_e16 a affx:Exon ; affx:startsAt "47225866" ; affx:stopsAt "47225941" ; affx:commonToAll "1" . :Slit2_e17 a affx:Exon ; affx:startsAt "47227518" ; affx:stopsAt "47227662" ; affx:commonToAll "1" . :Slit2_e18 a affx:Exon ; affx:startsAt "47230944" ; affx:stopsAt "47231088" ; affx:commonToAll "1" . :Slit2_e19 a affx:Exon ; affx:startsAt "47232862" ; affx:stopsAt "47233029" ; affx:commonToAll "1" . :Slit2_e20 a affx:Exon ; affx:startsAt "47233982" ; affx:stopsAt "47234115" ; affx:commonToAll "1" . :Slit2_e21 a affx:Exon ; affx:startsAt "47238156" ; affx:stopsAt "47238225" ; affx:commonToAll "1" . :Slit2_e22 a affx:Exon ; affx:startsAt "47240235" ; affx:stopsAt "47240307" ; affx:commonToAll "1" . :Slit2_e23 a affx:Exon ; affx:startsAt "47241184" ; affx:stopsAt "47241256" ; affx:commonToAll "1" . :Slit2_e24 a affx:Exon ; affx:startsAt "47242757" ; affx:stopsAt "47242829" ; affx:commonToAll "1" . :Slit2_e25 a affx:Exon ; affx:startsAt "47245385" ; affx:stopsAt "47245549" ; affx:commonToAll "1" . :Slit2_e26 a affx:Exon ; affx:startsAt "47252364" ; affx:stopsAt "47252489" ; affx:commonToAll "1" . :Slit2_e27 a affx:Exon ; affx:startsAt "47252613" ; affx:stopsAt "47252711" ; affx:commonToAll "1" . :Slit2_e28 a affx:Exon ; affx:startsAt "47255151" ; affx:stopsAt "47255291" ; affx:commonToAll "1" . :Slit2_e29 a affx:Exon ; affx:startsAt "47271189" ; affx:stopsAt "47271283" ; affx:commonToAll "1" . :Slit2_e30 a affx:Exon ; affx:startsAt "47277324" ; affx:stopsAt "47277462" ; affx:commonToAll "1" . :Slit2_e31 a affx:Exon ; affx:startsAt "47277552" ; affx:stopsAt "47277793" ; affx:commonToAll "1" . :Slit2_e32 a affx:Exon ; affx:startsAt "47278995" ; affx:stopsAt "47279126" ; affx:commonToAll "1" . :Slit2_e33 a affx:Exon ; affx:startsAt "47292016" ; affx:stopsAt "47292171" ; affx:commonToAll "1" . :Slit2_e34 a affx:Exon ; affx:startsAt "47297873" ; affx:stopsAt "47298162" ; affx:commonToAll "1" . :Slit2_e35 a affx:Exon ; affx:startsAt "47298360" ; affx:stopsAt "47298572" ; affx:commonToAll "1" . :Slit2_e36 a affx:Exon ; affx:startsAt "47299607" ; affx:stopsAt "47301120" ; affx:commonToAll "1" . :Gene4907 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi5748812] . :gi5748812 a affx:Transcript ; affx:unigene "iMm.34747" ; affx:translatesTo "MSTENVEGKPNNLGERGRARSSTFLRVFQPMFNHSIFTSAVSPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIADHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFSNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPTIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACLPPDPVNLSVSNDTTLAPEDLPTISSTDMYHNVTFDWAYLSKKECVKYGGKLVGNNCDFVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDNKPLDRERSSTFLERHTSC" ; affx:hasCds [affx:startsAt "88664209" ; affx:stopsAt "88871135" ]; affx:hasExon [ affx:relatesToExon :Gene4907_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e19; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e21; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e22; affx:cdsType "Partial" ; affx:cdsStop "88871135" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "9" ; affx:containsMotif [ affx:startsAt "425" ; affx:stopsAt "447" ; affx:spannedBy [ affx:startsAt "88771636" ; affx:stopsAt "88771702" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "460" ; affx:stopsAt "482" ; affx:spannedBy [ affx:startsAt "88785220" ; affx:stopsAt "88785286" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "511" ; affx:stopsAt "533" ; affx:spannedBy [ affx:startsAt "88792270" ; affx:stopsAt "88792336" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "682" ; affx:stopsAt "704" ; affx:spannedBy [ affx:startsAt "88833566" ; affx:stopsAt "88833632" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "731" ; affx:stopsAt "753" ; affx:spannedBy [ affx:startsAt "88835605" ; affx:stopsAt "88835671" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "774" ; affx:stopsAt "796" ; affx:spannedBy [ affx:startsAt "88850605" ; affx:stopsAt "88850671" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "834" ; affx:stopsAt "853" ; affx:spannedBy [ affx:startsAt "88851853" ; affx:stopsAt "88851910" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "860" ; affx:stopsAt "879" ; affx:spannedBy [ affx:startsAt "88859333" ; affx:stopsAt "88859384" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "88862064" ; affx:stopsAt "88862070" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "918" ; affx:stopsAt "940" ; affx:spannedBy [ affx:startsAt "88862187" ; affx:stopsAt "88862238" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "88865120" ; affx:stopsAt "88865135" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4907_e1 a affx:Exon ; affx:startsAt "88664209" ; affx:stopsAt "88664466" ; affx:commonToAll "1" . :Gene4907_e2 a affx:Exon ; affx:startsAt "88674488" ; affx:stopsAt "88674649" ; affx:commonToAll "1" . :Gene4907_e3 a affx:Exon ; affx:startsAt "88682250" ; affx:stopsAt "88682430" ; affx:commonToAll "1" . :Gene4907_e4 a affx:Exon ; affx:startsAt "88721434" ; affx:stopsAt "88721511" ; affx:commonToAll "1" . :Gene4907_e5 a affx:Exon ; affx:startsAt "88758307" ; affx:stopsAt "88758465" ; affx:commonToAll "1" . :Gene4907_e6 a affx:Exon ; affx:startsAt "88765544" ; affx:stopsAt "88765632" ; affx:commonToAll "1" . :Gene4907_e7 a affx:Exon ; affx:startsAt "88768276" ; affx:stopsAt "88768431" ; affx:commonToAll "1" . :Gene4907_e8 a affx:Exon ; affx:startsAt "88769062" ; affx:stopsAt "88769176" ; affx:commonToAll "1" . :Gene4907_e9 a affx:Exon ; affx:startsAt "88771551" ; affx:stopsAt "88771726" ; affx:commonToAll "1" . :Gene4907_e10 a affx:Exon ; affx:startsAt "88785205" ; affx:stopsAt "88785339" ; affx:commonToAll "1" . :Gene4907_e11 a affx:Exon ; affx:startsAt "88792236" ; affx:stopsAt "88792508" ; affx:commonToAll "1" . :Gene4907_e12 a affx:Exon ; affx:startsAt "88806656" ; affx:stopsAt "88806727" ; affx:commonToAll "1" . :Gene4907_e13 a affx:Exon ; affx:startsAt "88815558" ; affx:stopsAt "88815750" ; affx:commonToAll "1" . :Gene4907_e14 a affx:Exon ; affx:startsAt "88833554" ; affx:stopsAt "88833668" ; affx:commonToAll "1" . :Gene4907_e15 a affx:Exon ; affx:startsAt "88835560" ; affx:stopsAt "88835722" ; affx:commonToAll "1" . :Gene4907_e16 a affx:Exon ; affx:startsAt "88850593" ; affx:stopsAt "88850772" ; affx:commonToAll "1" . :Gene4907_e17 a affx:Exon ; affx:startsAt "88851840" ; affx:stopsAt "88851913" ; affx:commonToAll "1" . :Gene4907_e18 a affx:Exon ; affx:startsAt "88859315" ; affx:stopsAt "88859384" ; affx:commonToAll "1" . :Gene4907_e19 a affx:Exon ; affx:startsAt "88862064" ; affx:stopsAt "88862238" ; affx:commonToAll "1" . :Gene4907_e20 a affx:Exon ; affx:startsAt "88865120" ; affx:stopsAt "88865282" ; affx:commonToAll "1" . :Gene4907_e21 a affx:Exon ; affx:startsAt "88869058" ; affx:stopsAt "88869155" ; affx:commonToAll "1" . :Gene4907_e22 a affx:Exon ; affx:startsAt "88871091" ; affx:stopsAt "88871156" ; affx:commonToAll "1" . :Gene4908 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi16359301] ; affx:hasVariant [affx:representedBy :gi9651219] . :gi16359301 a affx:Transcript ; affx:unigene "iMm.41572" ; affx:translatesTo "MEGQDEVSAREQHFHSQVRESTICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLLLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRDSETTKPSANGHQKAL" ; affx:hasCds [affx:startsAt "27733767" ; affx:stopsAt "27878375" ]; affx:hasExon [ affx:relatesToExon :Gene4908_e1; affx:cdsType "Partial" ; affx:cdsStart "27733767" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e20; affx:cdsType "Partial" ; affx:cdsStop "27878375" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "21" ; affx:stopsAt "40" ; affx:spannedBy [ affx:startsAt "27878309" ; affx:stopsAt "27878312" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "27864084" ; affx:stopsAt "27864138" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "60" ; affx:stopsAt "82" ; affx:spannedBy [ affx:startsAt "27847578" ; affx:stopsAt "27847644" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "123" ; affx:stopsAt "145" ; affx:spannedBy [ affx:startsAt "27793564" ; affx:stopsAt "27793630" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "264" ; affx:stopsAt "286" ; affx:spannedBy [ affx:startsAt "27759384" ; affx:stopsAt "27759426" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27758817" ; affx:stopsAt "27758841" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "318" ; affx:stopsAt "340" ; affx:spannedBy [ affx:startsAt "27755251" ; affx:stopsAt "27755283" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27755004" ; affx:stopsAt "27755038" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "361" ; affx:stopsAt "383" ; affx:spannedBy [ affx:startsAt "27753448" ; affx:stopsAt "27753509" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27735839" ; affx:stopsAt "27735844" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "398" ; affx:stopsAt "420" ; affx:spannedBy [ affx:startsAt "27735728" ; affx:stopsAt "27735794" ; affx:inFrame "0" ] ; ] ; ] ; . :gi9651219 a affx:Transcript ; affx:unigene "iMm.41572" ; affx:translatesTo "MEGQDEVSAREQHFHSQVRESTICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLLLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRDSETTKPSANGHQKAL" ; affx:hasCds [affx:startsAt "27733767" ; affx:stopsAt "27878375" ]; affx:hasExon [ affx:relatesToExon :Gene4908_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "8" ; affx:containsMotif [ affx:startsAt "23" ; affx:stopsAt "40" ; affx:spannedBy [ affx:startsAt "27864084" ; affx:stopsAt "27864135" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "61" ; affx:stopsAt "83" ; affx:spannedBy [ affx:startsAt "27847575" ; affx:stopsAt "27847641" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "108" ; affx:stopsAt "130" ; affx:spannedBy [ affx:startsAt "27824617" ; affx:stopsAt "27824683" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "150" ; affx:stopsAt "172" ; affx:spannedBy [ affx:startsAt "27793564" ; affx:stopsAt "27793630" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "291" ; affx:stopsAt "313" ; affx:spannedBy [ affx:startsAt "27759384" ; affx:stopsAt "27759426" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27758817" ; affx:stopsAt "27758841" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "345" ; affx:stopsAt "367" ; affx:spannedBy [ affx:startsAt "27755251" ; affx:stopsAt "27755283" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27755004" ; affx:stopsAt "27755038" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "388" ; affx:stopsAt "410" ; affx:spannedBy [ affx:startsAt "27753448" ; affx:stopsAt "27753509" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27735839" ; affx:stopsAt "27735844" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "425" ; affx:stopsAt "447" ; affx:spannedBy [ affx:startsAt "27735728" ; affx:stopsAt "27735794" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4908_e1 a affx:Exon ; affx:startsAt "27733077" ; affx:stopsAt "27733853" ; affx:commonToAll "0" . :Gene4908_e2 a affx:Exon ; affx:startsAt "27733767" ; affx:stopsAt "27733853" ; affx:commonToAll "0" . :Gene4908_e3 a affx:Exon ; affx:startsAt "27735682" ; affx:stopsAt "27735844" ; affx:commonToAll "1" . :Gene4908_e4 a affx:Exon ; affx:startsAt "27753448" ; affx:stopsAt "27753515" ; affx:commonToAll "1" . :Gene4908_e5 a affx:Exon ; affx:startsAt "27754947" ; affx:stopsAt "27755038" ; affx:commonToAll "1" . :Gene4908_e6 a affx:Exon ; affx:startsAt "27755251" ; affx:stopsAt "27755325" ; affx:commonToAll "1" . :Gene4908_e7 a affx:Exon ; affx:startsAt "27758763" ; affx:stopsAt "27758841" ; affx:commonToAll "1" . :Gene4908_e8 a affx:Exon ; affx:startsAt "27759384" ; affx:stopsAt "27759461" ; affx:commonToAll "1" . :Gene4908_e9 a affx:Exon ; affx:startsAt "27764100" ; affx:stopsAt "27764181" ; affx:commonToAll "1" . :Gene4908_e10 a affx:Exon ; affx:startsAt "27788098" ; affx:stopsAt "27788171" ; affx:commonToAll "1" . :Gene4908_e11 a affx:Exon ; affx:startsAt "27791980" ; affx:stopsAt "27792045" ; affx:commonToAll "1" . :Gene4908_e12 a affx:Exon ; affx:startsAt "27792859" ; affx:stopsAt "27792928" ; affx:commonToAll "1" . :Gene4908_e13 a affx:Exon ; affx:startsAt "27793530" ; affx:stopsAt "27793657" ; affx:commonToAll "1" . :Gene4908_e14 a affx:Exon ; affx:startsAt "27824584" ; affx:stopsAt "27824607" ; affx:commonToAll "0" . :Gene4908_e15 a affx:Exon ; affx:startsAt "27824584" ; affx:stopsAt "27824688" ; affx:commonToAll "0" . :Gene4908_e16 a affx:Exon ; affx:startsAt "27847505" ; affx:stopsAt "27847645" ; affx:commonToAll "1" . :Gene4908_e17 a affx:Exon ; affx:startsAt "27861230" ; affx:stopsAt "27861270" ; affx:commonToAll "1" . :Gene4908_e18 a affx:Exon ; affx:startsAt "27864065" ; affx:stopsAt "27864138" ; affx:commonToAll "1" . :Gene4908_e19 a affx:Exon ; affx:startsAt "27878309" ; affx:stopsAt "27878375" ; affx:commonToAll "0" . :Gene4908_e20 a affx:Exon ; affx:startsAt "27878309" ; affx:stopsAt "27878413" ; affx:commonToAll "0" . :Gene4909 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi16741399] . :gi16741399 a affx:Transcript ; affx:unigene "iMm.66253" ; affx:translatesTo "MPGLWRAIALKTLLGYVSWSLYHGLSPMIYYFPLQTLELTGLEFFCVAFLSPILLTIPPLWKLVNKKWTLSLLRIVTVGSIASFEAPNAKLRLMVLALGVSSSLIVQTVTWWSGSGLQRYLKIWGFILGHVLLLVLRIWYTSLNPIWSYQMSNRVILTLSAVAVLDRIGTDGDYRNPEGKKPREVATGRTSLSSWLLPGAAFGSLLFLTHWIFGEVSIVSRWAVSGHPHPGPDPNPFGGAVLLGFSSGLMLSGSSWLHDAGLAWWMTGAASAMGLLYLRTWAAAVSGCVLAVFTGSMWPQVLGHLVNSGKNSGEAMATGMILYVLQTFFCAWCTAFKFVPGGVYARERSDVLLGTIMVIIGLSMLFGPKKNLDFLLQTKNSPKTLLRCSEKYMKLILWLFVGVGLLGLGLRHRTYERQLGRGAPATVVSAAIWPFRFGYDNEGWPNLERSAQLLKETGADFITILESDASKPYIGNNDLTMWLGEKLGFYTDFGPSTRDHTWGIMVLSRYPIVRSEHHLLPSPEGEIAPAITMTVNVSNRLVDFVVTHFGNHEDDLDRKLQAIAVSKLLKNCSNQVIFLGYITSEPGSRDYIQLTKHGNVKDIDSSDGDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPANYRDNQKVVIDHRGVPKNIHFNPRFGSYKEGHNYENTHHFHMNTPKYFV" ; affx:hasCds [affx:startsAt "72524993" ; affx:stopsAt "72571890" ]; affx:hasExon [ affx:relatesToExon :Gene4909_e1; affx:cdsType "Partial" ; affx:cdsStart "72524993" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e16; affx:cdsType "Partial" ; affx:cdsStop "72571890" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "19" ; affx:spannedBy [ affx:startsAt "72524993" ; affx:stopsAt "72525036" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "72526877" ; affx:stopsAt "72526891" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "9" ; affx:containsMotif [ affx:startsAt "39" ; affx:stopsAt "61" ; affx:spannedBy [ affx:startsAt "72526951" ; affx:stopsAt "72527017" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "91" ; affx:stopsAt "113" ; affx:spannedBy [ affx:startsAt "72530630" ; affx:stopsAt "72530696" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "123" ; affx:stopsAt "140" ; affx:spannedBy [ affx:startsAt "72531763" ; affx:stopsAt "72531814" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "191" ; affx:stopsAt "213" ; affx:spannedBy [ affx:startsAt "72533735" ; affx:stopsAt "72533801" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "236" ; affx:stopsAt "258" ; affx:spannedBy [ affx:startsAt "72533870" ; affx:stopsAt "72533875" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "72535449" ; affx:stopsAt "72535510" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "275" ; affx:stopsAt "297" ; affx:spannedBy [ affx:startsAt "72536708" ; affx:stopsAt "72536774" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "317" ; affx:stopsAt "339" ; affx:spannedBy [ affx:startsAt "72536834" ; affx:stopsAt "72536900" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "351" ; affx:stopsAt "368" ; affx:spannedBy [ affx:startsAt "72536936" ; affx:stopsAt "72536943" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "72540195" ; affx:stopsAt "72540239" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "395" ; affx:stopsAt "412" ; affx:spannedBy [ affx:startsAt "72542849" ; affx:stopsAt "72542899" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4909_e1 a affx:Exon ; affx:startsAt "72524881" ; affx:stopsAt "72525036" ; affx:commonToAll "1" . :Gene4909_e2 a affx:Exon ; affx:startsAt "72526877" ; affx:stopsAt "72527069" ; affx:commonToAll "1" . :Gene4909_e3 a affx:Exon ; affx:startsAt "72530592" ; affx:stopsAt "72530713" ; affx:commonToAll "1" . :Gene4909_e4 a affx:Exon ; affx:startsAt "72531750" ; affx:stopsAt "72531905" ; affx:commonToAll "1" . :Gene4909_e5 a affx:Exon ; affx:startsAt "72533673" ; affx:stopsAt "72533875" ; affx:commonToAll "1" . :Gene4909_e6 a affx:Exon ; affx:startsAt "72535449" ; affx:stopsAt "72535538" ; affx:commonToAll "1" . :Gene4909_e7 a affx:Exon ; affx:startsAt "72536685" ; affx:stopsAt "72536943" ; affx:commonToAll "1" . :Gene4909_e8 a affx:Exon ; affx:startsAt "72540195" ; affx:stopsAt "72540321" ; affx:commonToAll "1" . :Gene4909_e9 a affx:Exon ; affx:startsAt "72542849" ; affx:stopsAt "72542929" ; affx:commonToAll "1" . :Gene4909_e10 a affx:Exon ; affx:startsAt "72547501" ; affx:stopsAt "72547607" ; affx:commonToAll "1" . :Gene4909_e11 a affx:Exon ; affx:startsAt "72549346" ; affx:stopsAt "72549482" ; affx:commonToAll "1" . :Gene4909_e12 a affx:Exon ; affx:startsAt "72550758" ; affx:stopsAt "72550908" ; affx:commonToAll "1" . :Gene4909_e13 a affx:Exon ; affx:startsAt "72553158" ; affx:stopsAt "72553303" ; affx:commonToAll "1" . :Gene4909_e14 a affx:Exon ; affx:startsAt "72557369" ; affx:stopsAt "72557431" ; affx:commonToAll "1" . :Gene4909_e15 a affx:Exon ; affx:startsAt "72560239" ; affx:stopsAt "72560395" ; affx:commonToAll "1" . :Gene4909_e16 a affx:Exon ; affx:startsAt "72571811" ; affx:stopsAt "72572089" ; affx:commonToAll "1" . :Gene4910 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13278488] . :gi13278488 a affx:Transcript ; affx:unigene "iMm.190624" ; affx:translatesTo "MILLIFLKQRQAELEAVRLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKVCQTAGVAARMSARLEA" ; affx:hasCds [affx:startsAt "20202608" ; affx:stopsAt "20202836" ]; affx:hasExon [ affx:relatesToExon :Gene4910_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4910_e2; affx:cdsType "Partial" ; affx:cdsStart "20202608" ; affx:cdsStop "20202836" ; affx:frame "2"] ; . :Gene4910_e1 a affx:Exon ; affx:startsAt "20191403" ; affx:stopsAt "20191738" ; affx:commonToAll "1" . :Gene4910_e2 a affx:Exon ; affx:startsAt "20200553" ; affx:stopsAt "20202906" ; affx:commonToAll "1" . :Gene4911 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13542762] . :gi13542762 a affx:Transcript ; affx:unigene "iMm.30147" ; affx:translatesTo "MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKKTLAKPNMKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSDVPIRHSRNMRKMMLDLNKAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNETMGHSADRLAAAFAVSRMEQDEYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGRKTKVGSPPLEKFNIWGGSLSLGHPFGATGCRLVMAAANRLRKDGGQYALVAACAAGGQGHAMIVEAYPK" ; affx:hasCds [affx:startsAt "28670883" ; affx:stopsAt "28691295" ]; affx:hasExon [ affx:relatesToExon :Gene4911_e1; affx:cdsType "Partial" ; affx:cdsStart "28670883" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e15; affx:cdsType "Partial" ; affx:cdsStop "28691295" ; affx:frame "2"] ; . :Gene4911_e1 a affx:Exon ; affx:startsAt "28670873" ; affx:stopsAt "28670950" ; affx:commonToAll "1" . :Gene4911_e2 a affx:Exon ; affx:startsAt "28671232" ; affx:stopsAt "28671277" ; affx:commonToAll "1" . :Gene4911_e3 a affx:Exon ; affx:startsAt "28673871" ; affx:stopsAt "28673971" ; affx:commonToAll "1" . :Gene4911_e4 a affx:Exon ; affx:startsAt "28675730" ; affx:stopsAt "28675775" ; affx:commonToAll "1" . :Gene4911_e5 a affx:Exon ; affx:startsAt "28676702" ; affx:stopsAt "28676802" ; affx:commonToAll "1" . :Gene4911_e6 a affx:Exon ; affx:startsAt "28679832" ; affx:stopsAt "28679920" ; affx:commonToAll "1" . :Gene4911_e7 a affx:Exon ; affx:startsAt "28681016" ; affx:stopsAt "28681204" ; affx:commonToAll "1" . :Gene4911_e8 a affx:Exon ; affx:startsAt "28681997" ; affx:stopsAt "28682178" ; affx:commonToAll "1" . :Gene4911_e9 a affx:Exon ; affx:startsAt "28684094" ; affx:stopsAt "28684216" ; affx:commonToAll "1" . :Gene4911_e10 a affx:Exon ; affx:startsAt "28685846" ; affx:stopsAt "28685926" ; affx:commonToAll "1" . :Gene4911_e11 a affx:Exon ; affx:startsAt "28686003" ; affx:stopsAt "28686051" ; affx:commonToAll "1" . :Gene4911_e12 a affx:Exon ; affx:startsAt "28686758" ; affx:stopsAt "28686846" ; affx:commonToAll "1" . :Gene4911_e13 a affx:Exon ; affx:startsAt "28687521" ; affx:stopsAt "28687596" ; affx:commonToAll "1" . :Gene4911_e14 a affx:Exon ; affx:startsAt "28688127" ; affx:stopsAt "28688292" ; affx:commonToAll "1" . :Gene4911_e15 a affx:Exon ; affx:startsAt "28691259" ; affx:stopsAt "28691790" ; affx:commonToAll "1" . :Gene4912 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13278593] . :gi13278593 a affx:Transcript ; affx:unigene "iMm.33830" ; affx:translatesTo "MRLVILDNYDLASEWAAKYICNRIIKFKPGQDRYFSLGLPTGSTPLGCYKKLIEYHKSGNLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFEEKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAMEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLYSMKEGN" ; affx:hasCds [affx:startsAt "68658404" ; affx:stopsAt "68674288" ]; affx:hasExon [ affx:relatesToExon :Gene4912_e1; affx:cdsType "Partial" ; affx:cdsStart "68658404" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e6; affx:cdsType "Partial" ; affx:cdsStop "68674288" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e7; affx:cdsType "None" ] ; . :Gene4912_e1 a affx:Exon ; affx:startsAt "68657513" ; affx:stopsAt "68658466" ; affx:commonToAll "1" . :Gene4912_e2 a affx:Exon ; affx:startsAt "68660490" ; affx:stopsAt "68660665" ; affx:commonToAll "1" . :Gene4912_e3 a affx:Exon ; affx:startsAt "68664364" ; affx:stopsAt "68664549" ; affx:commonToAll "1" . :Gene4912_e4 a affx:Exon ; affx:startsAt "68669477" ; affx:stopsAt "68669660" ; affx:commonToAll "1" . :Gene4912_e5 a affx:Exon ; affx:startsAt "68670968" ; affx:stopsAt "68671070" ; affx:commonToAll "1" . :Gene4912_e6 a affx:Exon ; affx:startsAt "68674164" ; affx:stopsAt "68674327" ; affx:commonToAll "1" . :Gene4912_e7 a affx:Exon ; affx:startsAt "68676711" ; affx:stopsAt "68676789" ; affx:commonToAll "1" . :Gene4913 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13435573] . :gi13435573 a affx:Transcript ; affx:unigene "iMm.3981" ; affx:translatesTo "MAAAAAAGANGSGGSSGMEVDAAVPSVMASGVTGSVSVALHPLVILNISDHWIRMRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF" ; affx:hasCds [affx:startsAt "136866015" ; affx:stopsAt "136868779" ]; affx:hasExon [ affx:relatesToExon :Gene4913_e1; affx:cdsType "Partial" ; affx:cdsStart "136866015" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e10; affx:cdsType "Partial" ; affx:cdsStop "136868779" ; affx:frame "0"] ; . :Gene4913_e1 a affx:Exon ; affx:startsAt "136866005" ; affx:stopsAt "136866085" ; affx:commonToAll "1" . :Gene4913_e2 a affx:Exon ; affx:startsAt "136866277" ; affx:stopsAt "136866400" ; affx:commonToAll "1" . :Gene4913_e3 a affx:Exon ; affx:startsAt "136866576" ; affx:stopsAt "136866708" ; affx:commonToAll "1" . :Gene4913_e4 a affx:Exon ; affx:startsAt "136867039" ; affx:stopsAt "136867128" ; affx:commonToAll "1" . :Gene4913_e5 a affx:Exon ; affx:startsAt "136867224" ; affx:stopsAt "136867287" ; affx:commonToAll "1" . :Gene4913_e6 a affx:Exon ; affx:startsAt "136867637" ; affx:stopsAt "136867685" ; affx:commonToAll "1" . :Gene4913_e7 a affx:Exon ; affx:startsAt "136868032" ; affx:stopsAt "136868147" ; affx:commonToAll "1" . :Gene4913_e8 a affx:Exon ; affx:startsAt "136868229" ; affx:stopsAt "136868322" ; affx:commonToAll "1" . :Gene4913_e9 a affx:Exon ; affx:startsAt "136868411" ; affx:stopsAt "136868512" ; affx:commonToAll "1" . :Gene4913_e10 a affx:Exon ; affx:startsAt "136868638" ; affx:stopsAt "136868887" ; affx:commonToAll "1" . :Gene4914 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13529670] . :gi13529670 a affx:Transcript ; affx:unigene "iMm.32126" ; affx:translatesTo "MSRLQTEEQAVDSEGDSSLHRRNEEGTQSSHRMLGFSDALLSIIATVMILPVTHTEISPEQQFDKSIQKLLATRIAVYLMTFLIVTVAWTAHTRLFQVVGKIDDTLALLNLACMMTITLLPYTFSLMVTFPDVPLGIFLFCVCVIAIGSVQAMIVGYAFHFPHLLNPQIQCSTHRDLSRRHILHLVLRGPALCFVAAVFSLFFFPLSYLLMVTVIFLPHISKATTWCKDKLMGQRESPAHDMEPFSIDLHAPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVQEKFSGSLVAALGAYGPQFLAYFGSFATVGLLWFAHHSLFLHVRKATQTMGLLNILSLAFVGGLPLAYQQTSAFARQPHDELERVRVSCAIIFFASIFQFAIWTTALLHQTETLQPAVQFGGQEHAFMFAKLALYPCASLLAFAATCLLSRFSTAIFHLMQISVPFAFLLLRLLVRLALAGLQVLRGLWPHHPQQDQSEPEAQSQLLPDPC" ; affx:hasCds [affx:startsAt "106318030" ; affx:stopsAt "106326193" ]; affx:hasExon [ affx:relatesToExon :Gene4914_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4914_e2; affx:cdsType "Partial" ; affx:cdsStart "106318030" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e11; affx:cdsType "Partial" ; affx:cdsStop "106326193" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "70" ; affx:stopsAt "91" ; affx:spannedBy [ affx:startsAt "106319182" ; affx:stopsAt "106319245" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "106" ; affx:stopsAt "128" ; affx:spannedBy [ affx:startsAt "106321546" ; affx:stopsAt "106321561" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "106321804" ; affx:stopsAt "106321840" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "106322383" ; affx:stopsAt "106322398" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "135" ; affx:stopsAt "157" ; affx:spannedBy [ affx:startsAt "106322419" ; affx:stopsAt "106322467" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "106322726" ; affx:stopsAt "106322744" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "195" ; affx:stopsAt "217" ; affx:spannedBy [ affx:startsAt "106322858" ; affx:stopsAt "106322891" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "106323855" ; affx:stopsAt "106323888" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "334" ; affx:stopsAt "356" ; affx:spannedBy [ affx:startsAt "106325695" ; affx:stopsAt "106325761" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "373" ; affx:stopsAt "395" ; affx:spannedBy [ affx:startsAt "106325812" ; affx:stopsAt "106325878" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "415" ; affx:stopsAt "437" ; affx:spannedBy [ affx:startsAt "106325938" ; affx:stopsAt "106326004" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4914_e1 a affx:Exon ; affx:startsAt "106309634" ; affx:stopsAt "106309676" ; affx:commonToAll "1" . :Gene4914_e2 a affx:Exon ; affx:startsAt "106317956" ; affx:stopsAt "106318174" ; affx:commonToAll "1" . :Gene4914_e3 a affx:Exon ; affx:startsAt "106318350" ; affx:stopsAt "106318389" ; affx:commonToAll "1" . :Gene4914_e4 a affx:Exon ; affx:startsAt "106319155" ; affx:stopsAt "106319253" ; affx:commonToAll "1" . :Gene4914_e5 a affx:Exon ; affx:startsAt "106321509" ; affx:stopsAt "106321561" ; affx:commonToAll "1" . :Gene4914_e6 a affx:Exon ; affx:startsAt "106321804" ; affx:stopsAt "106321840" ; affx:commonToAll "1" . :Gene4914_e7 a affx:Exon ; affx:startsAt "106322383" ; affx:stopsAt "106322467" ; affx:commonToAll "1" . :Gene4914_e8 a affx:Exon ; affx:startsAt "106322726" ; affx:stopsAt "106322891" ; affx:commonToAll "1" . :Gene4914_e9 a affx:Exon ; affx:startsAt "106323855" ; affx:stopsAt "106323934" ; affx:commonToAll "1" . :Gene4914_e10 a affx:Exon ; affx:startsAt "106324244" ; affx:stopsAt "106324380" ; affx:commonToAll "1" . :Gene4914_e11 a affx:Exon ; affx:startsAt "106325526" ; affx:stopsAt "106326951" ; affx:commonToAll "1" . :Gene4915 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17391089] . :gi17391089 a affx:Transcript ; affx:unigene "iMm.22029" ; affx:translatesTo "MSEGESQTVVSSGSDPKVESSSLAPGLTSVSPPVTSTTSAASPEEEEESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADVKENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFIQHNGLIKIGSVAPDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAVDIYSFGMCALEMAVLEIQGNGESSYVPQEAISSAIQLLEDSLQREFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHCIVGHQHMIPENALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVRNGIYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTPEPAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNESIPDLAAELVQLGFISEADQSRLTSLLEETLNKFNFTRNSTLNTATVTVSS" ; affx:hasCds [affx:startsAt "29911845" ; affx:stopsAt "29919295" ]; affx:hasExon [ affx:relatesToExon :Gene4915_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4915_e2; affx:cdsType "Partial" ; affx:cdsStart "29911845" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e18; affx:cdsType "Partial" ; affx:cdsStop "29919295" ; affx:frame "1"] ; . :Gene4915_e1 a affx:Exon ; affx:startsAt "29909007" ; affx:stopsAt "29909066" ; affx:commonToAll "1" . :Gene4915_e2 a affx:Exon ; affx:startsAt "29911826" ; affx:stopsAt "29912055" ; affx:commonToAll "1" . :Gene4915_e3 a affx:Exon ; affx:startsAt "29912331" ; affx:stopsAt "29912454" ; affx:commonToAll "1" . :Gene4915_e4 a affx:Exon ; affx:startsAt "29912623" ; affx:stopsAt "29912725" ; affx:commonToAll "1" . :Gene4915_e5 a affx:Exon ; affx:startsAt "29913042" ; affx:stopsAt "29913132" ; affx:commonToAll "1" . :Gene4915_e6 a affx:Exon ; affx:startsAt "29913528" ; affx:stopsAt "29913569" ; affx:commonToAll "1" . :Gene4915_e7 a affx:Exon ; affx:startsAt "29913916" ; affx:stopsAt "29914011" ; affx:commonToAll "1" . :Gene4915_e8 a affx:Exon ; affx:startsAt "29915507" ; affx:stopsAt "29915591" ; affx:commonToAll "1" . :Gene4915_e9 a affx:Exon ; affx:startsAt "29915849" ; affx:stopsAt "29915908" ; affx:commonToAll "1" . :Gene4915_e10 a affx:Exon ; affx:startsAt "29916063" ; affx:stopsAt "29916162" ; affx:commonToAll "1" . :Gene4915_e11 a affx:Exon ; affx:startsAt "29917714" ; affx:stopsAt "29917847" ; affx:commonToAll "1" . :Gene4915_e12 a affx:Exon ; affx:startsAt "29918054" ; affx:stopsAt "29918160" ; affx:commonToAll "1" . :Gene4915_e13 a affx:Exon ; affx:startsAt "29918255" ; affx:stopsAt "29918306" ; affx:commonToAll "1" . :Gene4915_e14 a affx:Exon ; affx:startsAt "29918395" ; affx:stopsAt "29918531" ; affx:commonToAll "1" . :Gene4915_e15 a affx:Exon ; affx:startsAt "29918709" ; affx:stopsAt "29918763" ; affx:commonToAll "1" . :Gene4915_e16 a affx:Exon ; affx:startsAt "29918846" ; affx:stopsAt "29918910" ; affx:commonToAll "1" . :Gene4915_e17 a affx:Exon ; affx:startsAt "29919057" ; affx:stopsAt "29919113" ; affx:commonToAll "1" . :Gene4915_e18 a affx:Exon ; affx:startsAt "29919190" ; affx:stopsAt "29919730" ; affx:commonToAll "1" . :Gene4916 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13277965] . :gi13277965 a affx:Transcript ; affx:unigene "iMm.29784" ; affx:translatesTo "MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE" ; affx:hasCds [affx:startsAt "128674948" ; affx:stopsAt "128683955" ]; affx:hasExon [ affx:relatesToExon :Gene4916_e1; affx:cdsType "Partial" ; affx:cdsStart "128674948" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4916_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4916_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4916_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4916_e5; affx:cdsType "Partial" ; affx:cdsStop "128683955" ; affx:frame "1"] ; . :Gene4916_e1 a affx:Exon ; affx:startsAt "128674347" ; affx:stopsAt "128675077" ; affx:commonToAll "1" . :Gene4916_e2 a affx:Exon ; affx:startsAt "128676901" ; affx:stopsAt "128677066" ; affx:commonToAll "1" . :Gene4916_e3 a affx:Exon ; affx:startsAt "128679429" ; affx:stopsAt "128679630" ; affx:commonToAll "1" . :Gene4916_e4 a affx:Exon ; affx:startsAt "128682554" ; affx:stopsAt "128682684" ; affx:commonToAll "1" . :Gene4916_e5 a affx:Exon ; affx:startsAt "128683827" ; affx:stopsAt "128684080" ; affx:commonToAll "1" . :Gene4917 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13435415] . :gi13435415 a affx:Transcript ; affx:unigene "iMm.28890" ; affx:translatesTo "MGTLATRAACHGAHLALALLLLLSLSGPWLSAVVPGTPPLFNVSLDAAPEQRWLPMLRHYDPDFLRTAVAQVIGDRVPQWVLGMVGEIVSKVESFLPQPFTDEIRSICDSLNLSLADGILVNLAYEASAFCTSIVAQDSQGHIYHGRNLDYPFGKILRKLTANVQFIKNGQIAFTGTTFVGYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWLIRKTLSESESFEAAVYTLAKTPLIADVYYIVGGTSPKEGVVITRDRGGPADIWPLDPLNGEWFRVETNYDHWKPAPKVDDRRTPAIKALNATGQAHLNLETLFQVLSLFPVYNNYTIYTTVMSAAEPDKYLTMIRNPS" ; affx:hasCds [affx:startsAt "91916905" ; affx:stopsAt "91936483" ]; affx:hasExon [ affx:relatesToExon :Gene4917_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4917_e2; affx:cdsType "Partial" ; affx:cdsStart "91916905" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e11; affx:cdsType "Partial" ; affx:cdsStop "91936483" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "31" ; affx:spannedBy [ affx:startsAt "91936390" ; affx:stopsAt "91936483" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4917_e1 a affx:Exon ; affx:startsAt "91915597" ; affx:stopsAt "91916293" ; affx:commonToAll "1" . :Gene4917_e2 a affx:Exon ; affx:startsAt "91916903" ; affx:stopsAt "91916981" ; affx:commonToAll "1" . :Gene4917_e3 a affx:Exon ; affx:startsAt "91919287" ; affx:stopsAt "91919316" ; affx:commonToAll "1" . :Gene4917_e4 a affx:Exon ; affx:startsAt "91920859" ; affx:stopsAt "91920926" ; affx:commonToAll "1" . :Gene4917_e5 a affx:Exon ; affx:startsAt "91921760" ; affx:stopsAt "91921823" ; affx:commonToAll "1" . :Gene4917_e6 a affx:Exon ; affx:startsAt "91921941" ; affx:stopsAt "91922114" ; affx:commonToAll "1" . :Gene4917_e7 a affx:Exon ; affx:startsAt "91923431" ; affx:stopsAt "91923508" ; affx:commonToAll "1" . :Gene4917_e8 a affx:Exon ; affx:startsAt "91926392" ; affx:stopsAt "91926483" ; affx:commonToAll "1" . :Gene4917_e9 a affx:Exon ; affx:startsAt "91930794" ; affx:stopsAt "91930921" ; affx:commonToAll "1" . :Gene4917_e10 a affx:Exon ; affx:startsAt "91935269" ; affx:stopsAt "91935434" ; affx:commonToAll "1" . :Gene4917_e11 a affx:Exon ; affx:startsAt "91936262" ; affx:stopsAt "91936502" ; affx:commonToAll "1" . :Gene4918 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13542712] . :gi13542712 a affx:Transcript ; affx:unigene "iMm.110600" ; affx:translatesTo "MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDAKGSNSLPLLRSFLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFISRLAPTVA" ; affx:hasCds [affx:startsAt "66333336" ; affx:stopsAt "66359063" ]; affx:hasExon [ affx:relatesToExon :Gene4918_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4918_e2; affx:cdsType "Partial" ; affx:cdsStart "66333336" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e8; affx:cdsType "Partial" ; affx:cdsStop "66359063" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "27" ; affx:stopsAt "49" ; affx:spannedBy [ affx:startsAt "66336113" ; affx:stopsAt "66336172" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "66336617" ; affx:stopsAt "66336624" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "96" ; affx:stopsAt "118" ; affx:spannedBy [ affx:startsAt "66336765" ; affx:stopsAt "66336805" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "66339649" ; affx:stopsAt "66339675" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene4918_e1 a affx:Exon ; affx:startsAt "66333111" ; affx:stopsAt "66333154" ; affx:commonToAll "1" . :Gene4918_e2 a affx:Exon ; affx:startsAt "66333311" ; affx:stopsAt "66333381" ; affx:commonToAll "1" . :Gene4918_e3 a affx:Exon ; affx:startsAt "66336077" ; affx:stopsAt "66336172" ; affx:commonToAll "1" . :Gene4918_e4 a affx:Exon ; affx:startsAt "66336617" ; affx:stopsAt "66336805" ; affx:commonToAll "1" . :Gene4918_e5 a affx:Exon ; affx:startsAt "66339649" ; affx:stopsAt "66339717" ; affx:commonToAll "1" . :Gene4918_e6 a affx:Exon ; affx:startsAt "66340859" ; affx:stopsAt "66340993" ; affx:commonToAll "1" . :Gene4918_e7 a affx:Exon ; affx:startsAt "66356977" ; affx:stopsAt "66357061" ; affx:commonToAll "1" . :Gene4918_e8 a affx:Exon ; affx:startsAt "66358933" ; affx:stopsAt "66359367" ; affx:commonToAll "1" . :Gene4919 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13435427] . :gi13435427 a affx:Transcript ; affx:unigene "iMm.41555" ; affx:translatesTo "MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSEESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPLSRTVNPPRSSMCAVQ" ; affx:hasCds [affx:startsAt "40601337" ; affx:stopsAt "40683884" ]; affx:hasExon [ affx:relatesToExon :Gene4919_e1; affx:cdsType "Partial" ; affx:cdsStart "40601337" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e7; affx:cdsType "Partial" ; affx:cdsStop "40683884" ; affx:frame "2"] ; . :Gene4919_e1 a affx:Exon ; affx:startsAt "40600543" ; affx:stopsAt "40601430" ; affx:commonToAll "1" . :Gene4919_e2 a affx:Exon ; affx:startsAt "40608740" ; affx:stopsAt "40608818" ; affx:commonToAll "1" . :Gene4919_e3 a affx:Exon ; affx:startsAt "40611641" ; affx:stopsAt "40611745" ; affx:commonToAll "1" . :Gene4919_e4 a affx:Exon ; affx:startsAt "40663573" ; affx:stopsAt "40663703" ; affx:commonToAll "1" . :Gene4919_e5 a affx:Exon ; affx:startsAt "40674293" ; affx:stopsAt "40674382" ; affx:commonToAll "1" . :Gene4919_e6 a affx:Exon ; affx:startsAt "40679342" ; affx:stopsAt "40679439" ; affx:commonToAll "1" . :Gene4919_e7 a affx:Exon ; affx:startsAt "40683809" ; affx:stopsAt "40684060" ; affx:commonToAll "1" . :Gene4920 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13529469] . :gi13529469 a affx:Transcript ; affx:unigene "iMm.2462" ; affx:translatesTo "MPDYLGADQRKTKEEEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN" ; affx:hasCds [affx:startsAt "20223018" ; affx:stopsAt "20239908" ]; affx:hasExon [ affx:relatesToExon :Gene4920_e1; affx:cdsType "Partial" ; affx:cdsStart "20223018" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e12; affx:cdsType "Partial" ; affx:cdsStop "20239908" ; affx:frame "1"] ; . :Gene4920_e1 a affx:Exon ; affx:startsAt "20222968" ; affx:stopsAt "20223088" ; affx:commonToAll "1" . :Gene4920_e2 a affx:Exon ; affx:startsAt "20231311" ; affx:stopsAt "20231349" ; affx:commonToAll "1" . :Gene4920_e3 a affx:Exon ; affx:startsAt "20231966" ; affx:stopsAt "20232048" ; affx:commonToAll "1" . :Gene4920_e4 a affx:Exon ; affx:startsAt "20232736" ; affx:stopsAt "20232836" ; affx:commonToAll "1" . :Gene4920_e5 a affx:Exon ; affx:startsAt "20235626" ; affx:stopsAt "20235758" ; affx:commonToAll "1" . :Gene4920_e6 a affx:Exon ; affx:startsAt "20236139" ; affx:stopsAt "20236212" ; affx:commonToAll "1" . :Gene4920_e7 a affx:Exon ; affx:startsAt "20236747" ; affx:stopsAt "20236843" ; affx:commonToAll "1" . :Gene4920_e8 a affx:Exon ; affx:startsAt "20237411" ; affx:stopsAt "20237576" ; affx:commonToAll "1" . :Gene4920_e9 a affx:Exon ; affx:startsAt "20238729" ; affx:stopsAt "20238817" ; affx:commonToAll "1" . :Gene4920_e10 a affx:Exon ; affx:startsAt "20239273" ; affx:stopsAt "20239476" ; affx:commonToAll "1" . :Gene4920_e11 a affx:Exon ; affx:startsAt "20239569" ; affx:stopsAt "20239666" ; affx:commonToAll "1" . :Gene4920_e12 a affx:Exon ; affx:startsAt "20239750" ; affx:stopsAt "20239989" ; affx:commonToAll "1" . :Gene4921 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15214573] . :gi15214573 a affx:Transcript ; affx:unigene "iMm.100043" ; affx:translatesTo "MPSTKRYQHVIETPEPGEWELSGYEAAVPITEKSNPLTRNLDKADAEKIVQLLGQCDAEIFQEEGQIMPTYQRLYSESVLTTMLQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEELKKVAAGKKRVVVIGISVGLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDWRSTFRQVAERMQKMQEKQEAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGVVSSQRCLLEILRTFERAHQVTYSQSSKIATLTKQVGISLEKKGHVHLVGWQTLGIIAIMDGVECIHTFGADFRDIRGFLIGDHNDMFNQKDELSNQGPQFTFSQDDFLTSVLPSLTEIDTVVFIFTLDDNLAKVQALAERVREKSWNIQALVHSTVGQSLPAPLKKLFPSLISITWPLLFFDYEGSYVQKFQRELSTKWVLNTRFSGQSKARCIESLLQVIHFPQPLSNDVRAAPISCHVQVAHEKEKVIPTALLSLLLRCSITEAKERLAAASSVCEVVRSALSGPGQKRSIQAFGDPVVP" ; affx:hasCds [affx:startsAt "29965962" ; affx:stopsAt "29995438" ]; affx:hasExon [ affx:relatesToExon :Gene4921_e1; affx:cdsType "Partial" ; affx:cdsStart "29965962" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e19; affx:cdsType "Partial" ; affx:cdsStop "29995438" ; affx:frame "0"] ; . :Gene4921_e1 a affx:Exon ; affx:startsAt "29965923" ; affx:stopsAt "29966022" ; affx:commonToAll "1" . :Gene4921_e2 a affx:Exon ; affx:startsAt "29966507" ; affx:stopsAt "29966663" ; affx:commonToAll "1" . :Gene4921_e3 a affx:Exon ; affx:startsAt "29967056" ; affx:stopsAt "29967125" ; affx:commonToAll "1" . :Gene4921_e4 a affx:Exon ; affx:startsAt "29967900" ; affx:stopsAt "29967969" ; affx:commonToAll "1" . :Gene4921_e5 a affx:Exon ; affx:startsAt "29968341" ; affx:stopsAt "29968415" ; affx:commonToAll "1" . :Gene4921_e6 a affx:Exon ; affx:startsAt "29968921" ; affx:stopsAt "29968988" ; affx:commonToAll "1" . :Gene4921_e7 a affx:Exon ; affx:startsAt "29969154" ; affx:stopsAt "29969208" ; affx:commonToAll "1" . :Gene4921_e8 a affx:Exon ; affx:startsAt "29970503" ; affx:stopsAt "29970598" ; affx:commonToAll "1" . :Gene4921_e9 a affx:Exon ; affx:startsAt "29973315" ; affx:stopsAt "29973421" ; affx:commonToAll "1" . :Gene4921_e10 a affx:Exon ; affx:startsAt "29974834" ; affx:stopsAt "29974953" ; affx:commonToAll "1" . :Gene4921_e11 a affx:Exon ; affx:startsAt "29975412" ; affx:stopsAt "29975511" ; affx:commonToAll "1" . :Gene4921_e12 a affx:Exon ; affx:startsAt "29975667" ; affx:stopsAt "29975765" ; affx:commonToAll "1" . :Gene4921_e13 a affx:Exon ; affx:startsAt "29976101" ; affx:stopsAt "29976178" ; affx:commonToAll "1" . :Gene4921_e14 a affx:Exon ; affx:startsAt "29976531" ; affx:stopsAt "29976628" ; affx:commonToAll "1" . :Gene4921_e15 a affx:Exon ; affx:startsAt "29977182" ; affx:stopsAt "29977280" ; affx:commonToAll "1" . :Gene4921_e16 a affx:Exon ; affx:startsAt "29977367" ; affx:stopsAt "29977451" ; affx:commonToAll "1" . :Gene4921_e17 a affx:Exon ; affx:startsAt "29992918" ; affx:stopsAt "29992960" ; affx:commonToAll "1" . :Gene4921_e18 a affx:Exon ; affx:startsAt "29994703" ; affx:stopsAt "29994838" ; affx:commonToAll "1" . :Gene4921_e19 a affx:Exon ; affx:startsAt "29995273" ; affx:stopsAt "29995661" ; affx:commonToAll "1" . :Gene4922 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15214783] . :gi15214783 a affx:Transcript ; affx:unigene "iMm.200763" ; affx:translatesTo "MAAAVAGPLAAGGEEAAASVSLPGSPGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLKCLNPALGNLTALTYLNLSRNQLSSLPPYICQLPLRVLIISNNKLGALPPDISTLGSLRQLDVSSNELQSLPVELCSLRSLRDLNVRRNQLSTLPDELGDLPLVRLDFSCNRISRIPVSFCRLRHLQVVLLDSNPLQSPPAQICLKGKLHIFKYLTMEAGRRGAALGDLVPSRPPSFSPCPAEDLFPGRRYDGGLDSGFHSVDSGSKRWSGNESTDDFSELSFRISELARDPRGPRQPREDGAGDGDLEQIDFIDSHVPGEDEDRSAAEEQLPSELSLVAGDVEKPSSSRREEPAGEERRRPDTLQLWQERERKQQQQSGGWGSPRKDSVLKRGIRAAGAGASAPSTQATCNGPPKSSTTQLGVSGGQGAPTPPPTSQDPLPVSGPVTAPVPRPLGSIQRPNSFLFRSSSQSGSSPSSPESVLRPRPFPQEKELISQLRQVLESRLQQPLPEDLAEALANGVLLCQLANQLRPRSVPFIHVPSPAVPKLSALKSRKNVESFLEACRKMGVPEADLCSPSDLLRGTAQGLQTVLEAVILVGGKAPLPVQPSSGLGGFLLFYVVFMLLLYVVYTRLLGS" ; affx:hasCds [affx:startsAt "136345710" ; affx:stopsAt "136356649" ]; affx:hasExon [ affx:relatesToExon :Gene4922_e1; affx:cdsType "Partial" ; affx:cdsStart "136345710" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e18; affx:cdsType "Partial" ; affx:cdsStop "136356649" ; affx:frame "2"] ; . :Gene4922_e1 a affx:Exon ; affx:startsAt "136345686" ; affx:stopsAt "136345930" ; affx:commonToAll "1" . :Gene4922_e2 a affx:Exon ; affx:startsAt "136350075" ; affx:stopsAt "136350220" ; affx:commonToAll "1" . :Gene4922_e3 a affx:Exon ; affx:startsAt "136350352" ; affx:stopsAt "136350479" ; affx:commonToAll "1" . :Gene4922_e4 a affx:Exon ; affx:startsAt "136350647" ; affx:stopsAt "136350753" ; affx:commonToAll "1" . :Gene4922_e5 a affx:Exon ; affx:startsAt "136353242" ; affx:stopsAt "136353379" ; affx:commonToAll "1" . :Gene4922_e6 a affx:Exon ; affx:startsAt "136353488" ; affx:stopsAt "136353601" ; affx:commonToAll "1" . :Gene4922_e7 a affx:Exon ; affx:startsAt "136353716" ; affx:stopsAt "136353816" ; affx:commonToAll "1" . :Gene4922_e8 a affx:Exon ; affx:startsAt "136354048" ; affx:stopsAt "136354139" ; affx:commonToAll "1" . :Gene4922_e9 a affx:Exon ; affx:startsAt "136354229" ; affx:stopsAt "136354306" ; affx:commonToAll "1" . :Gene4922_e10 a affx:Exon ; affx:startsAt "136354408" ; affx:stopsAt "136354470" ; affx:commonToAll "1" . :Gene4922_e11 a affx:Exon ; affx:startsAt "136354569" ; affx:stopsAt "136354686" ; affx:commonToAll "1" . :Gene4922_e12 a affx:Exon ; affx:startsAt "136354796" ; affx:stopsAt "136354865" ; affx:commonToAll "1" . :Gene4922_e13 a affx:Exon ; affx:startsAt "136354942" ; affx:stopsAt "136355046" ; affx:commonToAll "1" . :Gene4922_e14 a affx:Exon ; affx:startsAt "136355158" ; affx:stopsAt "136355242" ; affx:commonToAll "1" . :Gene4922_e15 a affx:Exon ; affx:startsAt "136355625" ; affx:stopsAt "136355702" ; affx:commonToAll "1" . :Gene4922_e16 a affx:Exon ; affx:startsAt "136355853" ; affx:stopsAt "136355991" ; affx:commonToAll "1" . :Gene4922_e17 a affx:Exon ; affx:startsAt "136356081" ; affx:stopsAt "136356159" ; affx:commonToAll "1" . :Gene4922_e18 a affx:Exon ; affx:startsAt "136356451" ; affx:stopsAt "136357006" ; affx:commonToAll "1" . :Gene4923 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15030031] ; affx:hasVariant [affx:representedBy :gi18204450] . :gi15030031 a affx:Transcript ; affx:unigene "iMm.28685" ; affx:translatesTo "MAAQESLHVKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSVGGGGLLCGVVQGLREVGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEGRLQTPLASLVVIVCGGSNISLAQL" ; affx:hasCds [affx:startsAt "118534838" ; affx:stopsAt "118539494" ]; affx:hasExon [ affx:relatesToExon :Gene4923_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4923_e2; affx:cdsType "Partial" ; affx:cdsStart "118534838" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e9; affx:cdsType "Partial" ; affx:cdsStop "118539494" ; affx:frame "2"] ; . :gi18204450 a affx:Transcript ; affx:unigene "iMm.28685" ; affx:translatesTo "MAAQESLHVKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVAKALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSVGGGGLLCGVVQGLREVGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEGRLQTPLASLVVIVCGGSNISLAQLQALKVQLGLNGLPE" ; affx:hasCds [affx:startsAt "118534838" ; affx:stopsAt "118539536" ]; affx:hasExon [ affx:relatesToExon :Gene4923_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4923_e2; affx:cdsType "Partial" ; affx:cdsStart "118534838" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4923_e8; affx:cdsType "Partial" ; affx:cdsStop "118539536" ; affx:frame "2"] ; . :Gene4923_e1 a affx:Exon ; affx:startsAt "118532307" ; affx:stopsAt "118532355" ; affx:commonToAll "1" . :Gene4923_e2 a affx:Exon ; affx:startsAt "118534836" ; affx:stopsAt "118534991" ; affx:commonToAll "1" . :Gene4923_e3 a affx:Exon ; affx:startsAt "118536069" ; affx:stopsAt "118536109" ; affx:commonToAll "1" . :Gene4923_e4 a affx:Exon ; affx:startsAt "118536333" ; affx:stopsAt "118536473" ; affx:commonToAll "1" . :Gene4923_e5 a affx:Exon ; affx:startsAt "118536564" ; affx:stopsAt "118536656" ; affx:commonToAll "1" . :Gene4923_e6 a affx:Exon ; affx:startsAt "118537210" ; affx:stopsAt "118537438" ; affx:commonToAll "1" . :Gene4923_e7 a affx:Exon ; affx:startsAt "118538821" ; affx:stopsAt "118538946" ; affx:commonToAll "1" . :Gene4923_e8 a affx:Exon ; affx:startsAt "118539330" ; affx:stopsAt "118539667" ; affx:commonToAll "0" . :Gene4923_e9 a affx:Exon ; affx:startsAt "118539330" ; affx:stopsAt "118539690" ; affx:commonToAll "0" . :Gene4924 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18204498] . :gi18204498 a affx:Transcript ; affx:unigene "iMm.19390" ; affx:translatesTo "MGSITVRYFCYGCLFTSATWTVLLFIYFNFSEVTQPLRNVPIKGSGPHGPFPKKFYPRFTRGPGRVLDPQFKANRIDRLMNNHIEDPDKGLSKSSSELGMIFNERDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAECRRKSYPTDLPTASIVICFYNEAFSALLRTVHSVVDRTPAHLLHEIILVDDSSDFDDLKGELDEYIQRYLPAKVKVIRNMKREGLIRGRMIGAAHATGEVLVFLDSHCEVNVMWLQPLLAIILEDPHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHFKWDLVPVSELGGPDGATAPIRSPTMAGGLFAMNRQYFNDLGQYDSGMDIWGGENLEISFRIWMCGGKLFILPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPDLKNKSFGNISERVELRKKLGCQSFKWYLDNIYPEMQIPGPNAKPQQPVLINRGPKRPRVLQRGRLYHLQTNKCLVAQGRSSQKGGLVLLKTCDYGDPTQVWIYNEDHELILNNLLCLDMSETRSSDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRVMDLMDQKGYVGMAICDGSSSQQWRLEG" ; affx:hasCds [affx:startsAt "23721871" ; affx:stopsAt "23739827" ]; affx:hasExon [ affx:relatesToExon :Gene4924_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4924_e2; affx:cdsType "Partial" ; affx:cdsStart "23721871" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4924_e12; affx:cdsType "Partial" ; affx:cdsStop "23739827" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "36" ; affx:spannedBy [ affx:startsAt "23721871" ; affx:stopsAt "23721979" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4924_e1 a affx:Exon ; affx:startsAt "23697518" ; affx:stopsAt "23697647" ; affx:commonToAll "1" . :Gene4924_e2 a affx:Exon ; affx:startsAt "23721833" ; affx:stopsAt "23722166" ; affx:commonToAll "1" . :Gene4924_e3 a affx:Exon ; affx:startsAt "23723215" ; affx:stopsAt "23723339" ; affx:commonToAll "1" . :Gene4924_e4 a affx:Exon ; affx:startsAt "23724466" ; affx:stopsAt "23724633" ; affx:commonToAll "1" . :Gene4924_e5 a affx:Exon ; affx:startsAt "23726370" ; affx:stopsAt "23726496" ; affx:commonToAll "1" . :Gene4924_e6 a affx:Exon ; affx:startsAt "23729253" ; affx:stopsAt "23729503" ; affx:commonToAll "1" . :Gene4924_e7 a affx:Exon ; affx:startsAt "23731838" ; affx:stopsAt "23731956" ; affx:commonToAll "1" . :Gene4924_e8 a affx:Exon ; affx:startsAt "23733257" ; affx:stopsAt "23733410" ; affx:commonToAll "1" . :Gene4924_e9 a affx:Exon ; affx:startsAt "23736380" ; affx:stopsAt "23736599" ; affx:commonToAll "1" . :Gene4924_e10 a affx:Exon ; affx:startsAt "23737825" ; affx:stopsAt "23737930" ; affx:commonToAll "1" . :Gene4924_e11 a affx:Exon ; affx:startsAt "23739407" ; affx:stopsAt "23739545" ; affx:commonToAll "1" . :Gene4924_e12 a affx:Exon ; affx:startsAt "23739695" ; affx:stopsAt "23740364" ; affx:commonToAll "1" . :Gene4925 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15029895] . :gi15029895 a affx:Transcript ; affx:unigene "iMm.156892" ; affx:translatesTo "MFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY" ; affx:hasCds [affx:startsAt "97501306" ; affx:stopsAt "97506145" ]; affx:hasExon [ affx:relatesToExon :Gene4925_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4925_e2; affx:cdsType "Partial" ; affx:cdsStart "97501306" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4925_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4925_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4925_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4925_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4925_e7; affx:cdsType "Partial" ; affx:cdsStop "97506145" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4925_e8; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4925_e9; affx:cdsType "None" ] ; . :Gene4925_e1 a affx:Exon ; affx:startsAt "97499763" ; affx:stopsAt "97500095" ; affx:commonToAll "1" . :Gene4925_e2 a affx:Exon ; affx:startsAt "97501276" ; affx:stopsAt "97501374" ; affx:commonToAll "1" . :Gene4925_e3 a affx:Exon ; affx:startsAt "97502492" ; affx:stopsAt "97502639" ; affx:commonToAll "1" . :Gene4925_e4 a affx:Exon ; affx:startsAt "97502745" ; affx:stopsAt "97502845" ; affx:commonToAll "1" . :Gene4925_e5 a affx:Exon ; affx:startsAt "97503431" ; affx:stopsAt "97503563" ; affx:commonToAll "1" . :Gene4925_e6 a affx:Exon ; affx:startsAt "97504783" ; affx:stopsAt "97504945" ; affx:commonToAll "1" . :Gene4925_e7 a affx:Exon ; affx:startsAt "97505980" ; affx:stopsAt "97506149" ; affx:commonToAll "1" . :Gene4925_e8 a affx:Exon ; affx:startsAt "97515407" ; affx:stopsAt "97515464" ; affx:commonToAll "1" . :Gene4925_e9 a affx:Exon ; affx:startsAt "97517462" ; affx:stopsAt "97517684" ; affx:commonToAll "1" . :Gene4926 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi14198330] . :gi14198330 a affx:Transcript ; affx:unigene "iMm.27799" ; affx:translatesTo "MVRTDINAKKGSHHGAEVTQGLDRVKGAIAVEAGKGRSLDRGVGIGKSLDPEAETGRSQDLEAGIGNEGSELVPDPDPDTGIGLEAGADQGVEVEIERRELKNQEDLAEA" ; affx:hasCds [affx:startsAt "121836893" ; affx:stopsAt "121841109" ]; affx:hasExon [ affx:relatesToExon :Gene4926_e1; affx:cdsType "Partial" ; affx:cdsStart "121836893" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4926_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4926_e3; affx:cdsType "Partial" ; affx:cdsStop "121841109" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4926_e4; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4926_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4926_e6; affx:cdsType "None" ] ; . :Gene4926_e1 a affx:Exon ; affx:startsAt "121836820" ; affx:stopsAt "121836943" ; affx:commonToAll "1" . :Gene4926_e2 a affx:Exon ; affx:startsAt "121839753" ; affx:stopsAt "121839957" ; affx:commonToAll "1" . :Gene4926_e3 a affx:Exon ; affx:startsAt "121841030" ; affx:stopsAt "121841221" ; affx:commonToAll "1" . :Gene4926_e4 a affx:Exon ; affx:startsAt "121843996" ; affx:stopsAt "121844037" ; affx:commonToAll "1" . :Gene4926_e5 a affx:Exon ; affx:startsAt "121845313" ; affx:stopsAt "121845470" ; affx:commonToAll "1" . :Gene4926_e6 a affx:Exon ; affx:startsAt "121849647" ; affx:stopsAt "121849731" ; affx:commonToAll "1" . :Gene4927 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi14789677] . :gi14789677 a affx:Transcript ; affx:unigene "iMm.196595" ; affx:translatesTo "MKRVLVLLLALAFGHALERGRDYEKDKVCNELAMLGKEDFRSLSLILYSRKFSSSTFEQVNQLVKEVVSLTEECCAEGADPTCYDTRTSELSVKSCESDAPFPVHPGTPECCTKEGLERKLCMAALSHQPQEFPTYVEPTNDEICEAFRRDPKGFADQFLYEYSSNYGQAPLPLLVAYTKNYLSMVGSCCTSANPTVCFVKERLQMKHLSLLTTMSNRVCSQYAAYGKEKSRLSHLIKLAQKVPTANLENVLPLAEDFTEILSRCCESTSEDCMASELPEHTIKICQNLSKKNSKFEECCQENTPMNIFMCTYFMPAAEPLQLPAIKLPTGKDLCGQSTTQAMDQYTFELSRRTQVPEVFLSKVLEPTLKTLRECCDTQDSVACFSTQSPLLKRQLTSFIEKGQEMCADYSENTFTEYKKKLAERLRTKTPNTSPAELKDMVEKHSDFASKCCSINSPPLYCSSQIDAEMIDTLQS" ; affx:hasCds [affx:startsAt "89057904" ; affx:stopsAt "89095563" ]; affx:hasExon [ affx:relatesToExon :Gene4927_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4927_e2; affx:cdsType "Partial" ; affx:cdsStart "89057904" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4927_e13; affx:cdsType "Partial" ; affx:cdsStop "89095563" ; affx:frame "0"] ; . :Gene4927_e1 a affx:Exon ; affx:startsAt "89053362" ; affx:stopsAt "89053512" ; affx:commonToAll "1" . :Gene4927_e2 a affx:Exon ; affx:startsAt "89057881" ; affx:stopsAt "89057940" ; affx:commonToAll "1" . :Gene4927_e3 a affx:Exon ; affx:startsAt "89062725" ; affx:stopsAt "89062858" ; affx:commonToAll "1" . :Gene4927_e4 a affx:Exon ; affx:startsAt "89073020" ; affx:stopsAt "89073118" ; affx:commonToAll "1" . :Gene4927_e5 a affx:Exon ; affx:startsAt "89073588" ; affx:stopsAt "89073718" ; affx:commonToAll "1" . :Gene4927_e6 a affx:Exon ; affx:startsAt "89076089" ; affx:stopsAt "89076292" ; affx:commonToAll "1" . :Gene4927_e7 a affx:Exon ; affx:startsAt "89077376" ; affx:stopsAt "89077506" ; affx:commonToAll "1" . :Gene4927_e8 a affx:Exon ; affx:startsAt "89079045" ; affx:stopsAt "89079140" ; affx:commonToAll "1" . :Gene4927_e9 a affx:Exon ; affx:startsAt "89079406" ; affx:stopsAt "89079539" ; affx:commonToAll "1" . :Gene4927_e10 a affx:Exon ; affx:startsAt "89081248" ; affx:stopsAt "89081460" ; affx:commonToAll "1" . :Gene4927_e11 a affx:Exon ; affx:startsAt "89083141" ; affx:stopsAt "89083274" ; affx:commonToAll "1" . :Gene4927_e12 a affx:Exon ; affx:startsAt "89084343" ; affx:stopsAt "89084413" ; affx:commonToAll "1" . :Gene4927_e13 a affx:Exon ; affx:startsAt "89095505" ; affx:stopsAt "89095606" ; affx:commonToAll "1" . :Gene4928 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15012133] . :gi15012133 a affx:Transcript ; affx:unigene "iMm.2407" ; affx:translatesTo "MLAFLFYGLLLAACGSVTMSNPGESSFDLADRLDPVEKIDRLDLVEKIGDTHAKVLEIWMELGRRREVDAAEMHAICRVQPSATLPPDQPQITGLVLFRQLGPGSRLEAYFSLEGFPAEQNASNRAIHVHEFGDLSQGCDSTGPHYNPMEVPHPQHPGDFGNFVVRNGQLWRHRVGLTASLAGPHAILGRSVVVHAGEDDLGKGGNQASLQNGNAGRRLACCVVGTSSSAAWESQTKERKKRRRESECKTT" ; affx:hasCds [affx:startsAt "51437035" ; affx:stopsAt "51437791" ]; affx:hasExon [ affx:relatesToExon :Gene4928_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4928_e2; affx:cdsType "Partial" ; affx:cdsStart "51437035" ; affx:cdsStop "51437791" ; affx:frame "0"] ; . :Gene4928_e1 a affx:Exon ; affx:startsAt "51432748" ; affx:stopsAt "51432805" ; affx:commonToAll "1" . :Gene4928_e2 a affx:Exon ; affx:startsAt "51437017" ; affx:stopsAt "51438584" ; affx:commonToAll "1" . :Gene4929 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi14250242] . :gi14250242 a affx:Transcript ; affx:unigene "iMm.58660" ; affx:translatesTo "MKNIVSAFGIIPRNNRLMYIHSYQSYVWNTMVSRRIEEYGLRPVPGDLVLKGATPTYIEEDDVDNYSIHDVVMPLPGFDVIYPKHKISEAYREMLAADNLDIDNMRHTIRDYSLSGAYRRIIIRPQSVSWEVVAYDDPKIPLFNTDVDNLEGKPPPVFASEGKYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQLNTSWLR" ; affx:hasCds [affx:startsAt "22194103" ; affx:stopsAt "22200976" ]; affx:hasExon [ affx:relatesToExon :Gene4929_e1; affx:cdsType "Partial" ; affx:cdsStart "22194103" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4929_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4929_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4929_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4929_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4929_e6; affx:cdsType "Partial" ; affx:cdsStop "22200976" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4929_e7; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e8; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e9; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e10; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e11; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e12; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e13; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e14; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e15; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e16; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4929_e17; affx:cdsType "None" ] ; . :Gene4929_e1 a affx:Exon ; affx:startsAt "22193153" ; affx:stopsAt "22194240" ; affx:commonToAll "1" . :Gene4929_e2 a affx:Exon ; affx:startsAt "22194607" ; affx:stopsAt "22194699" ; affx:commonToAll "1" . :Gene4929_e3 a affx:Exon ; affx:startsAt "22195680" ; affx:stopsAt "22195810" ; affx:commonToAll "1" . :Gene4929_e4 a affx:Exon ; affx:startsAt "22198689" ; affx:stopsAt "22198791" ; affx:commonToAll "1" . :Gene4929_e5 a affx:Exon ; affx:startsAt "22200057" ; affx:stopsAt "22200184" ; affx:commonToAll "1" . :Gene4929_e6 a affx:Exon ; affx:startsAt "22200946" ; affx:stopsAt "22201107" ; affx:commonToAll "1" . :Gene4929_e7 a affx:Exon ; affx:startsAt "22202068" ; affx:stopsAt "22202130" ; affx:commonToAll "1" . :Gene4929_e8 a affx:Exon ; affx:startsAt "22204525" ; affx:stopsAt "22204537" ; affx:commonToAll "1" . :Gene4929_e9 a affx:Exon ; affx:startsAt "22204645" ; affx:stopsAt "22204687" ; affx:commonToAll "1" . :Gene4929_e10 a affx:Exon ; affx:startsAt "22206758" ; affx:stopsAt "22206887" ; affx:commonToAll "1" . :Gene4929_e11 a affx:Exon ; affx:startsAt "22212524" ; affx:stopsAt "22212602" ; affx:commonToAll "1" . :Gene4929_e12 a affx:Exon ; affx:startsAt "22214665" ; affx:stopsAt "22214777" ; affx:commonToAll "1" . :Gene4929_e13 a affx:Exon ; affx:startsAt "22221070" ; affx:stopsAt "22221215" ; affx:commonToAll "1" . :Gene4929_e14 a affx:Exon ; affx:startsAt "22227971" ; affx:stopsAt "22228073" ; affx:commonToAll "1" . :Gene4929_e15 a affx:Exon ; affx:startsAt "22228186" ; affx:stopsAt "22228271" ; affx:commonToAll "1" . :Gene4929_e16 a affx:Exon ; affx:startsAt "22230375" ; affx:stopsAt "22230802" ; affx:commonToAll "1" . :Gene4929_e17 a affx:Exon ; affx:startsAt "22235483" ; affx:stopsAt "22235637" ; affx:commonToAll "1" . :Gene4930 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi14318709] . :gi14318709 a affx:Transcript ; affx:unigene "iMm.41779" ; affx:translatesTo "MLKAKILFVGPCESGKTVLANFLTESSDITEYNPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDSKFESCWPALMKDAHGVVIVFNADIPSHLKEIEMWYSCFVQQQFLQDSHCMLVAHHKPGSGGERGSLALSPPLNKLKLVHSNLEEDPEEVRVEFIKYLKSIINSMSESRDREEMLIIT" ; affx:hasCds [affx:startsAt "135529846" ; affx:stopsAt "135534540" ]; affx:hasExon [ affx:relatesToExon :Gene4930_e1; affx:cdsType "Partial" ; affx:cdsStart "135529846" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4930_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4930_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4930_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4930_e5; affx:cdsType "Partial" ; affx:cdsStop "135534540" ; affx:frame "0"] ; . :Gene4930_e1 a affx:Exon ; affx:startsAt "135529764" ; affx:stopsAt "135529885" ; affx:commonToAll "1" . :Gene4930_e2 a affx:Exon ; affx:startsAt "135532690" ; affx:stopsAt "135532767" ; affx:commonToAll "1" . :Gene4930_e3 a affx:Exon ; affx:startsAt "135532868" ; affx:stopsAt "135532958" ; affx:commonToAll "1" . :Gene4930_e4 a affx:Exon ; affx:startsAt "135533255" ; affx:stopsAt "135533458" ; affx:commonToAll "1" . :Gene4930_e5 a affx:Exon ; affx:startsAt "135534391" ; affx:stopsAt "135534811" ; affx:commonToAll "1" . :Gene4931 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13879556] . :gi13879556 a affx:Transcript ; affx:unigene "iMm.200936" ; affx:translatesTo "MNEPTVQPSRTSSAPASPASPRGWSDFCEQHAAAAARELARQYWLFARAHPQPPRADLVSLQFAELFQRHFCREVRESLAGPPGHDYRATAPPRPALPKARSSEDLGPRPACALQHLRRGLRQLFRRRSAGELPGATSDTNDIDTTAASRPGPARKLLPWGLREPPTEALKEVVLRYSLADEAAMDSGARWQRGRLVLRSPGPGHSHFLQLFDPPKSSKPKLQEACSSIREVRPCTRLEMPDNLYTFVLKVQDQTDIIFEVGDEQQLNSWLAELRASTGLGLEHPDTELPLSLAAEPGPARSPRGSTDSLDQGASPGVLLDPACQKTDHFLSCYPWFHGPISRVRAAQLVQLQGPDAHGVFLVRQSESRRGEYVLTFNLQGRAKHLRLVLTERGQCRVQHLHFPSVVDMLRHFQRSPIPLECGAACDVRLSGYVVVLSQAPGSSNTVLFPFSLPHWDSELGHPHLSSVGCPPSHGAEALPGQVTPPEQIFHLVPSPEELANSLRQLELESVSSARDSDYDMDSSSRGHLRAIDNQYTPLSQLCREADV" ; affx:hasCds [affx:startsAt "119881904" ; affx:stopsAt "119893183" ]; affx:hasExon [ affx:relatesToExon :Gene4931_e1; affx:cdsType "Partial" ; affx:cdsStart "119881904" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4931_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4931_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4931_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4931_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4931_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4931_e7; affx:cdsType "Partial" ; affx:cdsStop "119893183" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4931_e8; affx:cdsType "None" ] ; . :Gene4931_e1 a affx:Exon ; affx:startsAt "119881348" ; affx:stopsAt "119882227" ; affx:commonToAll "1" . :Gene4931_e2 a affx:Exon ; affx:startsAt "119882349" ; affx:stopsAt "119882521" ; affx:commonToAll "1" . :Gene4931_e3 a affx:Exon ; affx:startsAt "119882598" ; affx:stopsAt "119882813" ; affx:commonToAll "1" . :Gene4931_e4 a affx:Exon ; affx:startsAt "119882893" ; affx:stopsAt "119882988" ; affx:commonToAll "1" . :Gene4931_e5 a affx:Exon ; affx:startsAt "119883072" ; affx:stopsAt "119883164" ; affx:commonToAll "1" . :Gene4931_e6 a affx:Exon ; affx:startsAt "119883240" ; affx:stopsAt "119883342" ; affx:commonToAll "1" . :Gene4931_e7 a affx:Exon ; affx:startsAt "119892535" ; affx:stopsAt "119893210" ; affx:commonToAll "1" . :Gene4931_e8 a affx:Exon ; affx:startsAt "119901449" ; affx:stopsAt "119901701" ; affx:commonToAll "1" . :Gene4932 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi14919412] . :gi14919412 a affx:Transcript ; affx:unigene "iMm.44208" ; affx:translatesTo "MVCKVLIALCIFTAGLRVQGSPTVPLPVSLMTKSSAPVATWTTSAPHTARATTPVASATHNASVLRTTAASLTSQLPTDHREEAVTSPPLKRDVNSTDSSPAGFPSTSSDGHLAPTPEEHSLGSPEATVPATGSQSPMLLSSQAPTSATTSPATSLSESLSASVTSSHNSTVANIQPTEAPMAPASPTEEHSSSHTPTSHVTAEPVPKEKSPQDTEPGKVICESETTTPFLIMQEVENALSSGSIAAITVTVIAVVLLVFGGAAYLKIRHSSYGRLLDDHDYGSWGNYNNPLYDDS" ; affx:hasCds [affx:startsAt "91163532" ; affx:stopsAt "91268255" ]; affx:hasExon [ affx:relatesToExon :Gene4932_e1; affx:cdsType "Partial" ; affx:cdsStart "91163532" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4932_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4932_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4932_e4; affx:cdsType "Partial" ; affx:cdsStop "91268255" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "20" ; affx:spannedBy [ affx:startsAt "91163532" ; affx:stopsAt "91163575" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "91239431" ; affx:stopsAt "91239448" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "244" ; affx:stopsAt "266" ; affx:spannedBy [ affx:startsAt "91258174" ; affx:stopsAt "91258240" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4932_e1 a affx:Exon ; affx:startsAt "91163317" ; affx:stopsAt "91163575" ; affx:commonToAll "1" . :Gene4932_e2 a affx:Exon ; affx:startsAt "91239431" ; affx:stopsAt "91240115" ; affx:commonToAll "1" . :Gene4932_e3 a affx:Exon ; affx:startsAt "91258169" ; affx:stopsAt "91258248" ; affx:commonToAll "1" . :Gene4932_e4 a affx:Exon ; affx:startsAt "91268170" ; affx:stopsAt "91269249" ; affx:commonToAll "1" . :Gene4933 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13905211] . :gi13905211 a affx:Transcript ; affx:unigene "iMm.153218" ; affx:translatesTo "MKISFIEPAILLNAFAMTLTIPLTAQYVYRRIWEETGNYTFASNSNGSECDQNKSSSIFAFREEVQKKASLFNLQVEMSALIPGLVSTFMLLASSDNHGRKLPMVLSSLGSLGTNTWLCMMSYFDLPLQLLIASTFIGALFGNYTTFWGACFAYIVDQQKEYKHRIIRIAILDFMLGVVTGLTGLSSGYFIRELGFVWSYFITAMVLIVNLAYILFFLNDPIKESSSQIVTMSCIESLKDLFYRTYMLFKNGSSKRQALLCLLIFTLVIYFFVIIGISPIFTLYELGPPLCWNEVYIGYGSALGSVSFLSSFLGIWLFSYCLKDIHIAYIGIFTTMVGMTLAAFTRTTLMMFLVRIPFIFTIMPLSVLRSMLSKVVHSTEQGALFACIAFLETLAGVTSTSAYSGIYSATVAWYPGFIFLLSAGLLVLPAISLCCVKSIGWEEGSYTLLVHEEPSEHTSD" ; affx:hasCds [affx:startsAt "146828461" ; affx:stopsAt "146843456" ]; affx:hasExon [ affx:relatesToExon :Gene4933_e1; affx:cdsType "Partial" ; affx:cdsStart "146828461" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4933_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4933_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4933_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4933_e5; affx:cdsType "Partial" ; affx:cdsStop "146843456" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4933_e6; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "25" ; affx:spannedBy [ affx:startsAt "146843381" ; affx:stopsAt "146843456" ; affx:inFrame "2" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "10" ; affx:containsMotif [ affx:startsAt "102" ; affx:stopsAt "124" ; affx:spannedBy [ affx:startsAt "146835987" ; affx:stopsAt "146836053" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "134" ; affx:stopsAt "156" ; affx:spannedBy [ affx:startsAt "146835891" ; affx:stopsAt "146835957" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "169" ; affx:stopsAt "191" ; affx:spannedBy [ affx:startsAt "146835786" ; affx:stopsAt "146835852" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "196" ; affx:stopsAt "218" ; affx:spannedBy [ affx:startsAt "146835705" ; affx:stopsAt "146835771" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "259" ; affx:stopsAt "281" ; affx:spannedBy [ affx:startsAt "146835516" ; affx:stopsAt "146835582" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "296" ; affx:stopsAt "318" ; affx:spannedBy [ affx:startsAt "146835405" ; affx:stopsAt "146835471" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "325" ; affx:stopsAt "344" ; affx:spannedBy [ affx:startsAt "146835327" ; affx:stopsAt "146835384" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "349" ; affx:stopsAt "371" ; affx:spannedBy [ affx:startsAt "146835299" ; affx:stopsAt "146835312" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "146833556" ; affx:stopsAt "146833609" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "384" ; affx:stopsAt "406" ; affx:spannedBy [ affx:startsAt "146829104" ; affx:stopsAt "146829170" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "411" ; affx:stopsAt "433" ; affx:spannedBy [ affx:startsAt "146829023" ; affx:stopsAt "146829089" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4933_e1 a affx:Exon ; affx:startsAt "146827778" ; affx:stopsAt "146828543" ; affx:commonToAll "1" . :Gene4933_e2 a affx:Exon ; affx:startsAt "146829021" ; affx:stopsAt "146829178" ; affx:commonToAll "1" . :Gene4933_e3 a affx:Exon ; affx:startsAt "146833525" ; affx:stopsAt "146833609" ; affx:commonToAll "1" . :Gene4933_e4 a affx:Exon ; affx:startsAt "146835299" ; affx:stopsAt "146836170" ; affx:commonToAll "1" . :Gene4933_e5 a affx:Exon ; affx:startsAt "146843267" ; affx:stopsAt "146843480" ; affx:commonToAll "1" . :Gene4933_e6 a affx:Exon ; affx:startsAt "146844143" ; affx:stopsAt "146844246" ; affx:commonToAll "1" . :Gene4934 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13905271] . :gi13905271 a affx:Transcript ; affx:unigene "iMm.138199" ; affx:translatesTo "MEEMSGDSVVSSAVPAAATRTTSFKGASPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTDSEGWILIDRCGKHFGTILNYLRDGGVPLPESRREIEELLAEAKYYLVQGLLEECQAALQNKDTYEPFCKVPVITSSKEEQRLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERERIERVRRIHIKRPDDRAHLHQ" ; affx:hasCds [affx:startsAt "112314476" ; affx:stopsAt "112329263" ]; affx:hasExon [ affx:relatesToExon :Gene4934_e1; affx:cdsType "Partial" ; affx:cdsStart "112314476" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4934_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4934_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4934_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4934_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4934_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4934_e7; affx:cdsType "Partial" ; affx:cdsStop "112329263" ; affx:frame "2"] ; . :Gene4934_e1 a affx:Exon ; affx:startsAt "112312406" ; affx:stopsAt "112314701" ; affx:commonToAll "1" . :Gene4934_e2 a affx:Exon ; affx:startsAt "112316043" ; affx:stopsAt "112316239" ; affx:commonToAll "1" . :Gene4934_e3 a affx:Exon ; affx:startsAt "112317176" ; affx:stopsAt "112317229" ; affx:commonToAll "1" . :Gene4934_e4 a affx:Exon ; affx:startsAt "112317775" ; affx:stopsAt "112317862" ; affx:commonToAll "1" . :Gene4934_e5 a affx:Exon ; affx:startsAt "112318893" ; affx:stopsAt "112319063" ; affx:commonToAll "1" . :Gene4934_e6 a affx:Exon ; affx:startsAt "112323730" ; affx:stopsAt "112323944" ; affx:commonToAll "1" . :Gene4934_e7 a affx:Exon ; affx:startsAt "112329260" ; affx:stopsAt "112329321" ; affx:commonToAll "1" . :Gene4935 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13543856] . :gi13543856 a affx:Transcript ; affx:unigene "iMm.17389" ; affx:translatesTo "MKLSEKNSAETKESQRKWSFSLVVAALVGAFGSSFLYGYNLSVVNAPTPYIKAFYNGTWYRRHGQPIDPDTLTLLWSVTVSIFAIGGLVGTLMVKMIGKFLGRKSTLLVNNGFAISAALLMACSLRAGTFEMLIVGRFIMGVDGGIALSALPMYLNEISPKEIRGSLGQVTAIFICIGVFSGQLLGLPELLGRIWFYTNSIFGKAGIPQDKIPYITLSTGGIETLAAIFSGLVIERLGRRPLLIGGFGLMALFFGTLTATLTLQDQAPWVPYLSIVCILAIIASFCSGPGGIPFILTGEFFQQSERPAAFMIAGTVNWLSNFAVGLLFPFIQKSLDSYCFLVFATICIAGATYFYFVLPETKNRTHAEISQAFAKRNKAQPPEVKADSAMTEEKANSQTEPDSSSTLDSYGQNKIV" ; affx:hasCds [affx:startsAt "37252057" ; affx:stopsAt "37384617" ]; affx:hasExon [ affx:relatesToExon :Gene4935_e1; affx:cdsType "Partial" ; affx:cdsStart "37252057" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e10; affx:cdsType "Partial" ; affx:cdsStop "37384617" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4935_e11; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "9" ; affx:containsMotif [ affx:startsAt "20" ; affx:stopsAt "42" ; affx:spannedBy [ affx:startsAt "37378332" ; affx:stopsAt "37378398" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "72" ; affx:stopsAt "94" ; affx:spannedBy [ affx:startsAt "37353576" ; affx:stopsAt "37353642" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "107" ; affx:stopsAt "129" ; affx:spannedBy [ affx:startsAt "37341104" ; affx:stopsAt "37341170" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "133" ; affx:stopsAt "155" ; affx:spannedBy [ affx:startsAt "37341058" ; affx:stopsAt "37341092" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "37337062" ; affx:stopsAt "37337094" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "212" ; affx:stopsAt "234" ; affx:spannedBy [ affx:startsAt "37292688" ; affx:stopsAt "37292742" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "37283107" ; affx:stopsAt "37283119" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "241" ; affx:stopsAt "263" ; affx:spannedBy [ affx:startsAt "37283020" ; affx:stopsAt "37283086" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "273" ; affx:stopsAt "295" ; affx:spannedBy [ affx:startsAt "37280892" ; affx:stopsAt "37280941" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "37263928" ; affx:stopsAt "37263945" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "308" ; affx:stopsAt "330" ; affx:spannedBy [ affx:startsAt "37263823" ; affx:stopsAt "37263889" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "340" ; affx:stopsAt "357" ; affx:spannedBy [ affx:startsAt "37252237" ; affx:stopsAt "37252288" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene4935_e1 a affx:Exon ; affx:startsAt "37250280" ; affx:stopsAt "37252312" ; affx:commonToAll "1" . :Gene4935_e2 a affx:Exon ; affx:startsAt "37263817" ; affx:stopsAt "37263945" ; affx:commonToAll "1" . :Gene4935_e3 a affx:Exon ; affx:startsAt "37280892" ; affx:stopsAt "37280968" ; affx:commonToAll "1" . :Gene4935_e4 a affx:Exon ; affx:startsAt "37283017" ; affx:stopsAt "37283119" ; affx:commonToAll "1" . :Gene4935_e5 a affx:Exon ; affx:startsAt "37292688" ; affx:stopsAt "37292799" ; affx:commonToAll "1" . :Gene4935_e6 a affx:Exon ; affx:startsAt "37336948" ; affx:stopsAt "37337094" ; affx:commonToAll "1" . :Gene4935_e7 a affx:Exon ; affx:startsAt "37341058" ; affx:stopsAt "37341183" ; affx:commonToAll "1" . :Gene4935_e8 a affx:Exon ; affx:startsAt "37353550" ; affx:stopsAt "37353711" ; affx:commonToAll "1" . :Gene4935_e9 a affx:Exon ; affx:startsAt "37378311" ; affx:stopsAt "37378410" ; affx:commonToAll "1" . :Gene4935_e10 a affx:Exon ; affx:startsAt "37384569" ; affx:stopsAt "37384638" ; affx:commonToAll "1" . :Gene4935_e11 a affx:Exon ; affx:startsAt "37403071" ; affx:stopsAt "37403265" ; affx:commonToAll "1" . :Gene4936 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17981477] . :gi17981477 a affx:Transcript ; affx:unigene "iMm.82567" ; affx:translatesTo "MPLVKRNIEPRHLCRGALPEGVTSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTIQDQQVVSKNSIPNPVADIYNQSDKPPPLSILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQKEQKRVDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVHHGASSEGSLSPDTRSHTSDVTDYSYPATPNHALQAQPATPSYTAGDAPLHGTTNQGAEHEYRPSSASARHMALNRPQQPPPPPPPQAPEGSQASTSVAPADYGMLPAQIIEYYSPSGPPPPPPPPMIPSAQTAFVSPLQMPTQPPFPASAVSTYPTPPHQPSTGLLATAPPPPGPPPPPPGPPGPSSLSSSPMHGPPVAEAKRPEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSRRIAVEYSDSDDDSEFDENDWSD" ; affx:hasCds [affx:startsAt "145385692" ; affx:stopsAt "145420452" ]; affx:hasExon [ affx:relatesToExon :Gene4936_e1; affx:cdsType "Partial" ; affx:cdsStart "145385692" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4936_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4936_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4936_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4936_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4936_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4936_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4936_e8; affx:cdsType "Partial" ; affx:cdsStop "145420452" ; affx:frame "0"] ; . :Gene4936_e1 a affx:Exon ; affx:startsAt "145385681" ; affx:stopsAt "145385825" ; affx:commonToAll "1" . :Gene4936_e2 a affx:Exon ; affx:startsAt "145402236" ; affx:stopsAt "145402371" ; affx:commonToAll "1" . :Gene4936_e3 a affx:Exon ; affx:startsAt "145403589" ; affx:stopsAt "145403743" ; affx:commonToAll "1" . :Gene4936_e4 a affx:Exon ; affx:startsAt "145405817" ; affx:stopsAt "145405935" ; affx:commonToAll "1" . :Gene4936_e5 a affx:Exon ; affx:startsAt "145411238" ; affx:stopsAt "145411414" ; affx:commonToAll "1" . :Gene4936_e6 a affx:Exon ; affx:startsAt "145416872" ; affx:stopsAt "145417139" ; affx:commonToAll "1" . :Gene4936_e7 a affx:Exon ; affx:startsAt "145418289" ; affx:stopsAt "145418654" ; affx:commonToAll "1" . :Gene4936_e8 a affx:Exon ; affx:startsAt "145420294" ; affx:stopsAt "145421192" ; affx:commonToAll "1" . :Bre a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17530322] . :gi17530322 a affx:Transcript ; affx:unigene "iMm.22543" ; affx:translatesTo "MSPEIALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKELVQQYHQFQCGRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGNEMAKRAKAYFKTFVPQFQEAAFANGKL" ; affx:hasCds [affx:startsAt "30370747" ; affx:stopsAt "30751947" ]; affx:hasExon [ affx:relatesToExon :Bre_e1; affx:cdsType "Partial" ; affx:cdsStart "30370747" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bre_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Bre_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bre_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bre_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bre_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Bre_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bre_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bre_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bre_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Bre_e11; affx:cdsType "Partial" ; affx:cdsStop "30751947" ; affx:frame "2"] ; . :Bre_e1 a affx:Exon ; affx:startsAt "30370720" ; affx:stopsAt "30370875" ; affx:commonToAll "1" . :Bre_e2 a affx:Exon ; affx:startsAt "30399868" ; affx:stopsAt "30399945" ; affx:commonToAll "1" . :Bre_e3 a affx:Exon ; affx:startsAt "30454576" ; affx:stopsAt "30454671" ; affx:commonToAll "1" . :Bre_e4 a affx:Exon ; affx:startsAt "30489484" ; affx:stopsAt "30489679" ; affx:commonToAll "1" . :Bre_e5 a affx:Exon ; affx:startsAt "30500091" ; affx:stopsAt "30500166" ; affx:commonToAll "1" . :Bre_e6 a affx:Exon ; affx:startsAt "30570071" ; affx:stopsAt "30570181" ; affx:commonToAll "1" . :Bre_e7 a affx:Exon ; affx:startsAt "30668084" ; affx:stopsAt "30668184" ; affx:commonToAll "1" . :Bre_e8 a affx:Exon ; affx:startsAt "30671433" ; affx:stopsAt "30671504" ; affx:commonToAll "1" . :Bre_e9 a affx:Exon ; affx:startsAt "30673958" ; affx:stopsAt "30674041" ; affx:commonToAll "1" . :Bre_e10 a affx:Exon ; affx:startsAt "30724742" ; affx:stopsAt "30724896" ; affx:commonToAll "1" . :Bre_e11 a affx:Exon ; affx:startsAt "30751883" ; affx:stopsAt "30752042" ; affx:commonToAll "1" . :Gene4938 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18490444] . :gi18490444 a affx:Transcript ; affx:unigene "iMm.5162" ; affx:translatesTo "MEGALAERVGAEPFHRVTPLLESWALSQVAGMPVFLKYENVQIAGSFKIRGIGHFCQQMAKRGCRHLVCSSGGNAGIAAAYSARKLGIPVTIVLPEGTSVQVVRRLEGEGAEVQLTGKVWDEANVKAQELATRDGWVNVSPFDHPLIWEGHASLVRELKESLGTPPGAVVLAVGGGGLLAGVTAGLLEVGWQHVPIVAMETRGAHSFNSALQAGRPVTLPDITSVAKSLGAKTVAARTLECAKECEVLSEVVEDREAVSAVQRFLDDERMLVEPACGAALAAIYSGILWRLQAEGRLSSALASVVVIVCGGNNISSQQLQELKIQLGCS" ; affx:hasCds [affx:startsAt "118514186" ; affx:stopsAt "118519034" ]; affx:hasExon [ affx:relatesToExon :Gene4938_e1; affx:cdsType "Partial" ; affx:cdsStart "118514186" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4938_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4938_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4938_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4938_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4938_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4938_e7; affx:cdsType "Partial" ; affx:cdsStop "118519034" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4938_e8; affx:cdsType "None" ] ; . :Gene4938_e1 a affx:Exon ; affx:startsAt "118514030" ; affx:stopsAt "118514380" ; affx:commonToAll "1" . :Gene4938_e2 a affx:Exon ; affx:startsAt "118515273" ; affx:stopsAt "118515398" ; affx:commonToAll "1" . :Gene4938_e3 a affx:Exon ; affx:startsAt "118515584" ; affx:stopsAt "118515812" ; affx:commonToAll "1" . :Gene4938_e4 a affx:Exon ; affx:startsAt "118516435" ; affx:stopsAt "118516524" ; affx:commonToAll "1" . :Gene4938_e5 a affx:Exon ; affx:startsAt "118517805" ; affx:stopsAt "118517945" ; affx:commonToAll "1" . :Gene4938_e6 a affx:Exon ; affx:startsAt "118518674" ; affx:stopsAt "118518714" ; affx:commonToAll "1" . :Gene4938_e7 a affx:Exon ; affx:startsAt "118518860" ; affx:stopsAt "118519054" ; affx:commonToAll "1" . :Gene4938_e8 a affx:Exon ; affx:startsAt "118528478" ; affx:stopsAt "118528521" ; affx:commonToAll "1" . :Gene4939 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15077325] . :gi15077325 a affx:Transcript ; affx:unigene "iMm.85429" ; affx:translatesTo "MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSHLQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQYFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVSQFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL" ; affx:hasCds [affx:startsAt "8143102" ; affx:stopsAt "8149694" ]; affx:hasExon [ affx:relatesToExon :Gene4939_e1; affx:cdsType "Partial" ; affx:cdsStart "8143102" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4939_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4939_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4939_e4; affx:cdsType "Partial" ; affx:cdsStop "8149694" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "117" ; affx:stopsAt "139" ; affx:spannedBy [ affx:startsAt "8145416" ; affx:stopsAt "8145482" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "164" ; affx:stopsAt "182" ; affx:spannedBy [ affx:startsAt "8145557" ; affx:stopsAt "8145611" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "218" ; affx:stopsAt "240" ; affx:spannedBy [ affx:startsAt "8146108" ; affx:stopsAt "8146174" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "252" ; affx:stopsAt "274" ; affx:spannedBy [ affx:startsAt "8146210" ; affx:stopsAt "8146216" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "8149436" ; affx:stopsAt "8149496" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "289" ; affx:stopsAt "311" ; affx:spannedBy [ affx:startsAt "8149541" ; affx:stopsAt "8149607" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4939_e1 a affx:Exon ; affx:startsAt "8143070" ; affx:stopsAt "8143186" ; affx:commonToAll "1" . :Gene4939_e2 a affx:Exon ; affx:startsAt "8145149" ; affx:stopsAt "8145662" ; affx:commonToAll "1" . :Gene4939_e3 a affx:Exon ; affx:startsAt "8146051" ; affx:stopsAt "8146216" ; affx:commonToAll "1" . :Gene4939_e4 a affx:Exon ; affx:startsAt "8149436" ; affx:stopsAt "8149788" ; affx:commonToAll "1" . :Gene4940 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi16359202] . :gi16359202 a affx:Transcript ; affx:unigene "iMm.15868" ; affx:translatesTo "MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQAMEHLIHVLQTDRSDSEIIAYALDTLYNIISNDEEEELEENSTRQSEDLGSQFTEIFIKQPENVTLLLSLLEEFDFHVRWPGVRLLTSLLKQLGPPVQQIILVSPMGVSRLMDLLADSREIIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIITEEGNSDGGIVVEDCLILLQNLLKTNNSNQNFFKEGSYIQRMKPWFEVGEENSGWSAQKVTNLHLMLQLVRVLVSPTNPPGATSSCQKAMFQCGLLQQLCTILMATGIPADILTETINTVSEVIRGCQVNQDYFASVNAPSNPPRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNEKGQGEIVATLLPSTIDATGNSVSAGQLLCGGLFSTDSLSNWCAAVALAHALQGNATQKEQLLRVQLATSIGNPPVSLLQQCTNILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNSLENYTKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTLEQHDNIVTHYKNMIREQDLQLEELKQQVSTLKCQNEQLQTAVTQQASQIQQHKDQYNLLKVQLGKDNHHQGSHGDGAQVNGIQPEEISRLREEIEELKSQQALLQGQLAEKDSLIENLKSSQASGMSEQASATCPPRDPEQVAELKQELTALKSQLCSQSLEITRLQTENCELLQRAETLAKSVPVEGESEHVSAAKTTDVEGRLSALLQETKELKNEIKALSEERTAIQKQLDSSNSTIAILQTEKDKLDLEVTDSKKEQDDLLVLLADQDQKILSLKSKLKDLGHPVEEEDESGDQEDDDDEIDDGDKDQDI" ; affx:hasCds [affx:startsAt "91794821" ; affx:stopsAt "91858791" ]; affx:hasExon [ affx:relatesToExon :Gene4940_e1; affx:cdsType "Partial" ; affx:cdsStart "91794821" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e21; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e22; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e23; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4940_e24; affx:cdsType "Partial" ; affx:cdsStop "91858791" ; affx:frame "2"] ; . :Gene4940_e1 a affx:Exon ; affx:startsAt "91794661" ; affx:stopsAt "91794887" ; affx:commonToAll "1" . :Gene4940_e2 a affx:Exon ; affx:startsAt "91809165" ; affx:stopsAt "91809252" ; affx:commonToAll "1" . :Gene4940_e3 a affx:Exon ; affx:startsAt "91809576" ; affx:stopsAt "91809641" ; affx:commonToAll "1" . :Gene4940_e4 a affx:Exon ; affx:startsAt "91815051" ; affx:stopsAt "91815128" ; affx:commonToAll "1" . :Gene4940_e5 a affx:Exon ; affx:startsAt "91823178" ; affx:stopsAt "91823279" ; affx:commonToAll "1" . :Gene4940_e6 a affx:Exon ; affx:startsAt "91823673" ; affx:stopsAt "91823776" ; affx:commonToAll "1" . :Gene4940_e7 a affx:Exon ; affx:startsAt "91823925" ; affx:stopsAt "91823981" ; affx:commonToAll "1" . :Gene4940_e8 a affx:Exon ; affx:startsAt "91827320" ; affx:stopsAt "91827441" ; affx:commonToAll "1" . :Gene4940_e9 a affx:Exon ; affx:startsAt "91830573" ; affx:stopsAt "91830752" ; affx:commonToAll "1" . :Gene4940_e10 a affx:Exon ; affx:startsAt "91834217" ; affx:stopsAt "91834358" ; affx:commonToAll "1" . :Gene4940_e11 a affx:Exon ; affx:startsAt "91837395" ; affx:stopsAt "91837484" ; affx:commonToAll "1" . :Gene4940_e12 a affx:Exon ; affx:startsAt "91838193" ; affx:stopsAt "91838348" ; affx:commonToAll "1" . :Gene4940_e13 a affx:Exon ; affx:startsAt "91838751" ; affx:stopsAt "91838963" ; affx:commonToAll "1" . :Gene4940_e14 a affx:Exon ; affx:startsAt "91844088" ; affx:stopsAt "91844199" ; affx:commonToAll "1" . :Gene4940_e15 a affx:Exon ; affx:startsAt "91844551" ; affx:stopsAt "91844670" ; affx:commonToAll "1" . :Gene4940_e16 a affx:Exon ; affx:startsAt "91844796" ; affx:stopsAt "91844978" ; affx:commonToAll "1" . :Gene4940_e17 a affx:Exon ; affx:startsAt "91846076" ; affx:stopsAt "91846198" ; affx:commonToAll "1" . :Gene4940_e18 a affx:Exon ; affx:startsAt "91849566" ; affx:stopsAt "91849705" ; affx:commonToAll "1" . :Gene4940_e19 a affx:Exon ; affx:startsAt "91850865" ; affx:stopsAt "91851029" ; affx:commonToAll "1" . :Gene4940_e20 a affx:Exon ; affx:startsAt "91852201" ; affx:stopsAt "91852288" ; affx:commonToAll "1" . :Gene4940_e21 a affx:Exon ; affx:startsAt "91855189" ; affx:stopsAt "91855288" ; affx:commonToAll "1" . :Gene4940_e22 a affx:Exon ; affx:startsAt "91856670" ; affx:stopsAt "91856778" ; affx:commonToAll "1" . :Gene4940_e23 a affx:Exon ; affx:startsAt "91857988" ; affx:stopsAt "91858204" ; affx:commonToAll "1" . :Gene4940_e24 a affx:Exon ; affx:startsAt "91858710" ; affx:stopsAt "91859649" ; affx:commonToAll "1" . :Gene4941 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi16741087] . :gi16741087 a affx:Transcript ; affx:unigene "iMm.200912" ; affx:translatesTo "MGNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI" ; affx:hasCds [affx:startsAt "113995300" ; affx:stopsAt "114004903" ]; affx:hasExon [ affx:relatesToExon :Gene4941_e1; affx:cdsType "Partial" ; affx:cdsStart "113995300" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4941_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4941_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4941_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4941_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4941_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4941_e7; affx:cdsType "Partial" ; affx:cdsStop "114004903" ; affx:frame "2"] ; . :Gene4941_e1 a affx:Exon ; affx:startsAt "113994241" ; affx:stopsAt "113995378" ; affx:commonToAll "1" . :Gene4941_e2 a affx:Exon ; affx:startsAt "113995565" ; affx:stopsAt "113995634" ; affx:commonToAll "1" . :Gene4941_e3 a affx:Exon ; affx:startsAt "113998599" ; affx:stopsAt "113998733" ; affx:commonToAll "1" . :Gene4941_e4 a affx:Exon ; affx:startsAt "114000655" ; affx:stopsAt "114000770" ; affx:commonToAll "1" . :Gene4941_e5 a affx:Exon ; affx:startsAt "114001025" ; affx:stopsAt "114001119" ; affx:commonToAll "1" . :Gene4941_e6 a affx:Exon ; affx:startsAt "114002136" ; affx:stopsAt "114002300" ; affx:commonToAll "1" . :Gene4941_e7 a affx:Exon ; affx:startsAt "114004744" ; affx:stopsAt "114005082" ; affx:commonToAll "1" . :Gene4942 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15929719] . :gi15929719 a affx:Transcript ; affx:unigene "iMm.33649" ; affx:translatesTo "MGSAAMDTKKKKEVSSPGGSSGKKNPSLKRRSLRVHIPDLSSFAMPLLDGDVENSEKHSSRKVDSPFSSGSPSRGLFSRGPQPRPSSPVSAPVRPKTSPGSPKTVFPFSYQESPPRSPRRMSFSGIFRSSSKESSPNSNPSTSPGGIRFFSRSRKTSSVSSSPSTPTQVTKQHPFPLESYKQEPERPESRIYASSSPPDTGQRFCLAFQSPARPPLASPTYHAPLRTAVLAAAPGPAEAGMLEKLEFQEEEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCSKLETLETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALILTPAGAKQKETETE" ; affx:hasCds [affx:startsAt "23332869" ; affx:stopsAt "23576054" ]; affx:hasExon [ affx:relatesToExon :Gene4942_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4942_e2; affx:cdsType "Partial" ; affx:cdsStart "23332869" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4942_e17; affx:cdsType "Partial" ; affx:cdsStop "23576054" ; affx:frame "2"] ; . :Gene4942_e1 a affx:Exon ; affx:startsAt "23331564" ; affx:stopsAt "23331730" ; affx:commonToAll "1" . :Gene4942_e2 a affx:Exon ; affx:startsAt "23331940" ; affx:stopsAt "23332901" ; affx:commonToAll "1" . :Gene4942_e3 a affx:Exon ; affx:startsAt "23334889" ; affx:stopsAt "23334983" ; affx:commonToAll "1" . :Gene4942_e4 a affx:Exon ; affx:startsAt "23338064" ; affx:stopsAt "23338211" ; affx:commonToAll "1" . :Gene4942_e5 a affx:Exon ; affx:startsAt "23339988" ; affx:stopsAt "23340026" ; affx:commonToAll "1" . :Gene4942_e6 a affx:Exon ; affx:startsAt "23340427" ; affx:stopsAt "23340593" ; affx:commonToAll "1" . :Gene4942_e7 a affx:Exon ; affx:startsAt "23342817" ; affx:stopsAt "23342944" ; affx:commonToAll "1" . :Gene4942_e8 a affx:Exon ; affx:startsAt "23344094" ; affx:stopsAt "23344149" ; affx:commonToAll "1" . :Gene4942_e9 a affx:Exon ; affx:startsAt "23345973" ; affx:stopsAt "23346019" ; affx:commonToAll "1" . :Gene4942_e10 a affx:Exon ; affx:startsAt "23347691" ; affx:stopsAt "23347750" ; affx:commonToAll "1" . :Gene4942_e11 a affx:Exon ; affx:startsAt "23349670" ; affx:stopsAt "23349752" ; affx:commonToAll "1" . :Gene4942_e12 a affx:Exon ; affx:startsAt "23358138" ; affx:stopsAt "23358242" ; affx:commonToAll "1" . :Gene4942_e13 a affx:Exon ; affx:startsAt "23377409" ; affx:stopsAt "23377479" ; affx:commonToAll "1" . :Gene4942_e14 a affx:Exon ; affx:startsAt "23421668" ; affx:stopsAt "23421883" ; affx:commonToAll "1" . :Gene4942_e15 a affx:Exon ; affx:startsAt "23497384" ; affx:stopsAt "23497664" ; affx:commonToAll "1" . :Gene4942_e16 a affx:Exon ; affx:startsAt "23504057" ; affx:stopsAt "23504129" ; affx:commonToAll "1" . :Gene4942_e17 a affx:Exon ; affx:startsAt "23575940" ; affx:stopsAt "23576360" ; affx:commonToAll "1" . :Gene4943 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15488850] . :gi15488850 a affx:Transcript ; affx:unigene "iMm.29276" ; affx:translatesTo "MKECPMPRNAARISEKRKEYMDACGEASGQSFQQRYHAEEVEERFGRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLKEAELENSGLALYDGNDDADGETETGEIQNKNVTYDLSKLVNYPGFNISTPRGIPDEWRMFGSIPMQACQQKDVFASYLNSNIQSPSMRSSGKRSSSQSSPNSPKKQRKEGSAAASPADMELDSDVEIPPGSQSSKAFQFQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQARPAASAMDEDALTLEELEEQQRQIWAALQQAEGGNGDSDVPGDTPLTGNSVASSPCPNEFDLPVPEGKALEKPVLAEPQEPAASVDTAGPEPSCSPAAGAAVLSQREEEAAAEGGPGDALLDNGGVLNMNMSNGSNQQPIHPDSRPPMAPKTHSPVPDMSKFATGITPFEFENMAESTGMYLRIRNLLKNSPRNQQKNKKTCE" ; affx:hasCds [affx:startsAt "121800445" ; affx:stopsAt "121808691" ]; affx:hasExon [ affx:relatesToExon :Gene4943_e1; affx:cdsType "Partial" ; affx:cdsStart "121800445" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4943_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4943_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4943_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4943_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4943_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4943_e7; affx:cdsType "Partial" ; affx:cdsStop "121808691" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4943_e8; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4943_e9; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4943_e10; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4943_e11; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4943_e12; affx:cdsType "None" ] ; . :Gene4943_e1 a affx:Exon ; affx:startsAt "121799899" ; affx:stopsAt "121801224" ; affx:commonToAll "1" . :Gene4943_e2 a affx:Exon ; affx:startsAt "121802664" ; affx:stopsAt "121802782" ; affx:commonToAll "1" . :Gene4943_e3 a affx:Exon ; affx:startsAt "121803094" ; affx:stopsAt "121803181" ; affx:commonToAll "1" . :Gene4943_e4 a affx:Exon ; affx:startsAt "121804624" ; affx:stopsAt "121804743" ; affx:commonToAll "1" . :Gene4943_e5 a affx:Exon ; affx:startsAt "121807370" ; affx:stopsAt "121807513" ; affx:commonToAll "1" . :Gene4943_e6 a affx:Exon ; affx:startsAt "121808093" ; affx:stopsAt "121808236" ; affx:commonToAll "1" . :Gene4943_e7 a affx:Exon ; affx:startsAt "121808673" ; affx:stopsAt "121808734" ; affx:commonToAll "1" . :Gene4943_e8 a affx:Exon ; affx:startsAt "121809296" ; affx:stopsAt "121809362" ; affx:commonToAll "1" . :Gene4943_e9 a affx:Exon ; affx:startsAt "121809483" ; affx:stopsAt "121809587" ; affx:commonToAll "1" . :Gene4943_e10 a affx:Exon ; affx:startsAt "121814235" ; affx:stopsAt "121814313" ; affx:commonToAll "1" . :Gene4943_e11 a affx:Exon ; affx:startsAt "121814794" ; affx:stopsAt "121814900" ; affx:commonToAll "1" . :Gene4943_e12 a affx:Exon ; affx:startsAt "121817153" ; affx:stopsAt "121817230" ; affx:commonToAll "1" . :Gene4944 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi16740729] . :gi16740729 a affx:Transcript ; affx:unigene "iMm.27142" ; affx:translatesTo "MLRFPTCFPSFRVVGEKQLPQEIIFLAWSPKRDLIALANTTGEVLLHRLASFHRVWSFPPNESTGKEVTCLAWRPDGKLLAFALADTKKIILCDVEKPESLHSFSVEAPVSCMHWTEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYNSTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCIALCLSSDLKSLSVVTEVSSGGESEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKPTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSTHLKESPLLFPYYPRKSLHFVKRRMENVIDQCLQKPADVIGRSMNQAICIPLYKDARSMDCARRLLKFPFLWNNKTSNLHYLLFTILEDSVYKMCILRRHTDISQSVSNGLIGIKFGSFTSASADKVRRSSYSCLDAQFYDDETVTVILKDSMGREGRDRILVQLSLSLVYNSEDSDEYEFTGSYSTRLDEQGSIIPTRTMHFEKHWRLLESMRAQYVAGNGLRKVSCVLSSNLRHVRVFEMDIDDEWEIDESSDDEEEAGGKPVKIKEEVLSESETEAHQDAAALDPDVVIKVEKLDPELDS" ; affx:hasCds [affx:startsAt "51903075" ; affx:stopsAt "51935431" ]; affx:hasExon [ affx:relatesToExon :Gene4944_e1; affx:cdsType "Partial" ; affx:cdsStart "51903075" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e19; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e21; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e22; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e24; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e25; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e26; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e27; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4944_e28; affx:cdsType "Partial" ; affx:cdsStop "51935431" ; affx:frame "0"] ; . :Gene4944_e1 a affx:Exon ; affx:startsAt "51902963" ; affx:stopsAt "51903204" ; affx:commonToAll "1" . :Gene4944_e2 a affx:Exon ; affx:startsAt "51904489" ; affx:stopsAt "51904595" ; affx:commonToAll "1" . :Gene4944_e3 a affx:Exon ; affx:startsAt "51908433" ; affx:stopsAt "51908566" ; affx:commonToAll "1" . :Gene4944_e4 a affx:Exon ; affx:startsAt "51910527" ; affx:stopsAt "51910602" ; affx:commonToAll "1" . :Gene4944_e5 a affx:Exon ; affx:startsAt "51910716" ; affx:stopsAt "51910743" ; affx:commonToAll "1" . :Gene4944_e6 a affx:Exon ; affx:startsAt "51910835" ; affx:stopsAt "51910880" ; affx:commonToAll "1" . :Gene4944_e7 a affx:Exon ; affx:startsAt "51911632" ; affx:stopsAt "51911717" ; affx:commonToAll "1" . :Gene4944_e8 a affx:Exon ; affx:startsAt "51912298" ; affx:stopsAt "51912403" ; affx:commonToAll "1" . :Gene4944_e9 a affx:Exon ; affx:startsAt "51914135" ; affx:stopsAt "51914219" ; affx:commonToAll "1" . :Gene4944_e10 a affx:Exon ; affx:startsAt "51915443" ; affx:stopsAt "51915530" ; affx:commonToAll "1" . :Gene4944_e11 a affx:Exon ; affx:startsAt "51916802" ; affx:stopsAt "51916867" ; affx:commonToAll "1" . :Gene4944_e12 a affx:Exon ; affx:startsAt "51917405" ; affx:stopsAt "51917448" ; affx:commonToAll "1" . :Gene4944_e13 a affx:Exon ; affx:startsAt "51917566" ; affx:stopsAt "51917643" ; affx:commonToAll "1" . :Gene4944_e14 a affx:Exon ; affx:startsAt "51919269" ; affx:stopsAt "51919370" ; affx:commonToAll "1" . :Gene4944_e15 a affx:Exon ; affx:startsAt "51919454" ; affx:stopsAt "51919506" ; affx:commonToAll "1" . :Gene4944_e16 a affx:Exon ; affx:startsAt "51924395" ; affx:stopsAt "51924451" ; affx:commonToAll "1" . :Gene4944_e17 a affx:Exon ; affx:startsAt "51924655" ; affx:stopsAt "51924702" ; affx:commonToAll "1" . :Gene4944_e18 a affx:Exon ; affx:startsAt "51925619" ; affx:stopsAt "51925676" ; affx:commonToAll "1" . :Gene4944_e19 a affx:Exon ; affx:startsAt "51925982" ; affx:stopsAt "51926039" ; affx:commonToAll "1" . :Gene4944_e20 a affx:Exon ; affx:startsAt "51927924" ; affx:stopsAt "51928018" ; affx:commonToAll "1" . :Gene4944_e21 a affx:Exon ; affx:startsAt "51930054" ; affx:stopsAt "51930152" ; affx:commonToAll "1" . :Gene4944_e22 a affx:Exon ; affx:startsAt "51930760" ; affx:stopsAt "51930822" ; affx:commonToAll "1" . :Gene4944_e23 a affx:Exon ; affx:startsAt "51930902" ; affx:stopsAt "51930941" ; affx:commonToAll "1" . :Gene4944_e24 a affx:Exon ; affx:startsAt "51931033" ; affx:stopsAt "51931135" ; affx:commonToAll "1" . :Gene4944_e25 a affx:Exon ; affx:startsAt "51932398" ; affx:stopsAt "51932473" ; affx:commonToAll "1" . :Gene4944_e26 a affx:Exon ; affx:startsAt "51933290" ; affx:stopsAt "51933464" ; affx:commonToAll "1" . :Gene4944_e27 a affx:Exon ; affx:startsAt "51934705" ; affx:stopsAt "51934829" ; affx:commonToAll "1" . :Gene4944_e28 a affx:Exon ; affx:startsAt "51935206" ; affx:stopsAt "51935554" ; affx:commonToAll "1" . :Gene4945 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi16741583] . :gi16741583 a affx:Transcript ; affx:unigene "iMm.195706" ; affx:translatesTo "MVTLITEKLQNQSLDDLTRRACEAGPYSAEKLNKSGHLFPLEISVDKSPWKALRGGWPTGSQAASGPFSVGPHGVSHTEGLKWQLESPGPMDVGHFLDLHDSTGPPAAPPTKRHCRSLSEPEELARCRSPWRPGSSKVWTPISKRRCNSGGSATLQCCSGVGNPTLQGTLVPGLPRRPVSPAGPTSPLTPRPASASSGFVDGSEGSTSSGPPWLSTGPCPFSSRRRLSLSQEHLVDTGACLPSASSTPTSTPELGRHHGLLRCRSQPCVLDGRRVRRKRRREEDARWTRPSLDFLKMTRTLKNSKSLCSLDYEDDEDDTQEKTLVSSPCNSQGLVGIITPSSSPRIPRPGPDSPSIWASGEPEANPGEGGSSGDPSDWDSAGEEGIFPLDHGDLDLEQIENN" ; affx:hasCds [affx:startsAt "32300261" ; affx:stopsAt "32314373" ]; affx:hasExon [ affx:relatesToExon :Gene4945_e1; affx:cdsType "Partial" ; affx:cdsStart "32300261" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4945_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4945_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4945_e4; affx:cdsType "Partial" ; affx:cdsStop "32314373" ; affx:frame "2"] ; . :Gene4945_e1 a affx:Exon ; affx:startsAt "32300045" ; affx:stopsAt "32300573" ; affx:commonToAll "1" . :Gene4945_e2 a affx:Exon ; affx:startsAt "32307156" ; affx:stopsAt "32307920" ; affx:commonToAll "1" . :Gene4945_e3 a affx:Exon ; affx:startsAt "32310124" ; affx:stopsAt "32310179" ; affx:commonToAll "1" . :Gene4945_e4 a affx:Exon ; affx:startsAt "32314295" ; affx:stopsAt "32314376" ; affx:commonToAll "1" . :Gene4946 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18033967] . :gi18033967 a affx:Transcript ; affx:unigene "iMm.1158" ; affx:translatesTo "MLCIFGYLIFMIIYKWLAYSAETSREAPSILIEFINMFLFPTSKTHGLYPGQAHVQRVLVALTVLAVPVLFLGKPLFLLWLHNGRNCFGMSRSGYTLVRKDSEEEVSLLGNQDIEEGNSRMEEGCREVTCEEFNFGEILMTQAIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWAMLMRVGLRVDTTYGVLLLLPVMAFFAVLTIFILLVMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPFSFSLLSSKFSNDDSIA" ; affx:hasCds [affx:startsAt "122954270" ; affx:stopsAt "122959714" ]; affx:hasExon [ affx:relatesToExon :Gene4946_e1; affx:cdsType "Partial" ; affx:cdsStart "122954270" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4946_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4946_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4946_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4946_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4946_e6; affx:cdsType "Partial" ; affx:cdsStop "122959714" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "18" ; affx:spannedBy [ affx:startsAt "122954270" ; affx:stopsAt "122954324" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "58" ; affx:stopsAt "80" ; affx:spannedBy [ affx:startsAt "122955814" ; affx:stopsAt "122955880" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "192" ; affx:stopsAt "214" ; affx:spannedBy [ affx:startsAt "122957823" ; affx:stopsAt "122957889" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4946_e1 a affx:Exon ; affx:startsAt "122954215" ; affx:stopsAt "122954426" ; affx:commonToAll "1" . :Gene4946_e2 a affx:Exon ; affx:startsAt "122955796" ; affx:stopsAt "122955916" ; affx:commonToAll "1" . :Gene4946_e3 a affx:Exon ; affx:startsAt "122956349" ; affx:stopsAt "122956469" ; affx:commonToAll "1" . :Gene4946_e4 a affx:Exon ; affx:startsAt "122956959" ; affx:stopsAt "122957077" ; affx:commonToAll "1" . :Gene4946_e5 a affx:Exon ; affx:startsAt "122957761" ; affx:stopsAt "122957933" ; affx:commonToAll "1" . :Gene4946_e6 a affx:Exon ; affx:startsAt "122959608" ; affx:stopsAt "122960064" ; affx:commonToAll "1" . :Gene4947 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13097023] . :gi13097023 a affx:Transcript ; affx:unigene "iMm.21629" ; affx:translatesTo "MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDAVTEPQVAEEKIEEANGRETTGDGEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSEKTPLQCVMEVDTERAMLEREAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV" ; affx:hasCds [affx:startsAt "23033188" ; affx:stopsAt "23044016" ]; affx:hasExon [ affx:relatesToExon :Gene4947_e1; affx:cdsType "Partial" ; affx:cdsStart "23033188" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4947_e13; affx:cdsType "Partial" ; affx:cdsStop "23044016" ; affx:frame "0"] ; . :Gene4947_e1 a affx:Exon ; affx:startsAt "23032667" ; affx:stopsAt "23033326" ; affx:commonToAll "1" . :Gene4947_e2 a affx:Exon ; affx:startsAt "23033801" ; affx:stopsAt "23034005" ; affx:commonToAll "1" . :Gene4947_e3 a affx:Exon ; affx:startsAt "23034506" ; affx:stopsAt "23034635" ; affx:commonToAll "1" . :Gene4947_e4 a affx:Exon ; affx:startsAt "23034823" ; affx:stopsAt "23034886" ; affx:commonToAll "1" . :Gene4947_e5 a affx:Exon ; affx:startsAt "23035527" ; affx:stopsAt "23035638" ; affx:commonToAll "1" . :Gene4947_e6 a affx:Exon ; affx:startsAt "23035889" ; affx:stopsAt "23035979" ; affx:commonToAll "1" . :Gene4947_e7 a affx:Exon ; affx:startsAt "23036060" ; affx:stopsAt "23036180" ; affx:commonToAll "1" . :Gene4947_e8 a affx:Exon ; affx:startsAt "23036393" ; affx:stopsAt "23036489" ; affx:commonToAll "1" . :Gene4947_e9 a affx:Exon ; affx:startsAt "23038472" ; affx:stopsAt "23038575" ; affx:commonToAll "1" . :Gene4947_e10 a affx:Exon ; affx:startsAt "23039331" ; affx:stopsAt "23039427" ; affx:commonToAll "1" . :Gene4947_e11 a affx:Exon ; affx:startsAt "23040750" ; affx:stopsAt "23041105" ; affx:commonToAll "1" . :Gene4947_e12 a affx:Exon ; affx:startsAt "23041495" ; affx:stopsAt "23041708" ; affx:commonToAll "1" . :Gene4947_e13 a affx:Exon ; affx:startsAt "23043847" ; affx:stopsAt "23044056" ; affx:commonToAll "1" . :Gene4948 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13097107] . :gi13097107 a affx:Transcript ; affx:unigene "iMm.35097" ; affx:translatesTo "MVMAAKKGPGPGGGVGGSKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVLFLQSRGNEVCRKIWLGLFDARTSLIPDSRDPQKVKEFLQEKYEKKRWYVPPEQVKGPSYSKGSVSATPVQGSVPEGKPIRTLLGDPVPSLSDPASTSSQPGSQSQARSSSQARSSQPPSHSSTKKASTDLLADIGGDPFAAPQVVPAFASFPGFGGKYYPGAGTRLRRICITAKTSLVHRGLTFLCGWGQGAA" ; affx:hasCds [affx:startsAt "136379822" ; affx:stopsAt "136401439" ]; affx:hasExon [ affx:relatesToExon :Gene4948_e1; affx:cdsType "Partial" ; affx:cdsStart "136379822" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4948_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4948_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4948_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4948_e5; affx:cdsType "Partial" ; affx:cdsStop "136401439" ; affx:frame "1"] ; . :Gene4948_e1 a affx:Exon ; affx:startsAt "136379312" ; affx:stopsAt "136380107" ; affx:commonToAll "1" . :Gene4948_e2 a affx:Exon ; affx:startsAt "136380718" ; affx:stopsAt "136380875" ; affx:commonToAll "1" . :Gene4948_e3 a affx:Exon ; affx:startsAt "136383563" ; affx:stopsAt "136383679" ; affx:commonToAll "1" . :Gene4948_e4 a affx:Exon ; affx:startsAt "136384183" ; affx:stopsAt "136384277" ; affx:commonToAll "1" . :Gene4948_e5 a affx:Exon ; affx:startsAt "136401218" ; affx:stopsAt "136401553" ; affx:commonToAll "1" . :Gene4949 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13097131] . :gi13097131 a affx:Transcript ; affx:unigene "iMm.21241" ; affx:translatesTo "MPRYAQLVMGPAGSGKSTYCSTMVQHCEALNRSVQVVNLDPAAEHFNYPVMADIRELIEVDDVMEDESLRFGPNGGLVFCMEYFANNFDWLENCLGHVEDDYILFDCPGQIELYTHLPVMKQLVQQLEQWEFRVCGVFLVDSQFMVESFKFISGILAALSAMVSLEIPQVNIMTKMDLLSKKAKKEIEKFLDPDMYSLIDDSTGDLRSQKFKKLTKAVCGLVDDYSMVRFLPYDQSDEESMNIVLQHIDFAIQYGEDLEFKEPREHEEESSSMFDEYFQERQNE" ; affx:hasCds [affx:startsAt "120442996" ; affx:stopsAt "120452714" ]; affx:hasExon [ affx:relatesToExon :Gene4949_e1; affx:cdsType "Partial" ; affx:cdsStart "120442996" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4949_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4949_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4949_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4949_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4949_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4949_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4949_e8; affx:cdsType "Partial" ; affx:cdsStop "120452714" ; affx:frame "1"] ; . :Gene4949_e1 a affx:Exon ; affx:startsAt "120442895" ; affx:stopsAt "120443044" ; affx:commonToAll "1" . :Gene4949_e2 a affx:Exon ; affx:startsAt "120444298" ; affx:stopsAt "120444407" ; affx:commonToAll "1" . :Gene4949_e3 a affx:Exon ; affx:startsAt "120448857" ; affx:stopsAt "120449025" ; affx:commonToAll "1" . :Gene4949_e4 a affx:Exon ; affx:startsAt "120450371" ; affx:stopsAt "120450496" ; affx:commonToAll "1" . :Gene4949_e5 a affx:Exon ; affx:startsAt "120451580" ; affx:stopsAt "120451696" ; affx:commonToAll "1" . :Gene4949_e6 a affx:Exon ; affx:startsAt "120451788" ; affx:stopsAt "120451885" ; affx:commonToAll "1" . :Gene4949_e7 a affx:Exon ; affx:startsAt "120452438" ; affx:stopsAt "120452567" ; affx:commonToAll "1" . :Gene4949_e8 a affx:Exon ; affx:startsAt "120452651" ; affx:stopsAt "120453171" ; affx:commonToAll "1" . :Gene4950 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13277917] . :gi13277917 a affx:Transcript ; affx:unigene "iMm.889" ; affx:translatesTo "MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL" ; affx:hasCds [affx:startsAt "142631421" ; affx:stopsAt "142652243" ]; affx:hasExon [ affx:relatesToExon :Gene4950_e1; affx:cdsType "Partial" ; affx:cdsStart "142631421" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4950_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4950_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4950_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4950_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4950_e6; affx:cdsType "Partial" ; affx:cdsStop "142652243" ; affx:frame "1"] ; . :Gene4950_e1 a affx:Exon ; affx:startsAt "142629919" ; affx:stopsAt "142631552" ; affx:commonToAll "1" . :Gene4950_e2 a affx:Exon ; affx:startsAt "142631773" ; affx:stopsAt "142631933" ; affx:commonToAll "1" . :Gene4950_e3 a affx:Exon ; affx:startsAt "142632542" ; affx:stopsAt "142632605" ; affx:commonToAll "1" . :Gene4950_e4 a affx:Exon ; affx:startsAt "142639115" ; affx:stopsAt "142639233" ; affx:commonToAll "1" . :Gene4950_e5 a affx:Exon ; affx:startsAt "142641603" ; affx:stopsAt "142641675" ; affx:commonToAll "1" . :Gene4950_e6 a affx:Exon ; affx:startsAt "142652208" ; affx:stopsAt "142652428" ; affx:commonToAll "1" . :Gene4951 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi12805410] . :gi12805410 a affx:Transcript ; affx:unigene "iMm.21450" ; affx:translatesTo "MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE" ; affx:hasCds [affx:startsAt "29567631" ; affx:stopsAt "29567745" ]; affx:hasExon [ affx:relatesToExon :Gene4951_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4951_e2; affx:cdsType "Partial" ; affx:cdsStart "29567631" ; affx:cdsStop "29567745" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "30" ; affx:spannedBy [ affx:startsAt "29567655" ; affx:stopsAt "29567745" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene4951_e1 a affx:Exon ; affx:startsAt "29566727" ; affx:stopsAt "29566976" ; affx:commonToAll "1" . :Gene4951_e2 a affx:Exon ; affx:startsAt "29567608" ; affx:stopsAt "29567935" ; affx:commonToAll "1" . :Gene4952 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi12805282] . :gi12805282 a affx:Transcript ; affx:unigene "iMm.30204" ; affx:translatesTo "MAASGEARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVVVKMTDSFTEQADQVTADVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDMMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTELTPAYF" ; affx:hasCds [affx:startsAt "44399801" ; affx:stopsAt "44415331" ]; affx:hasExon [ affx:relatesToExon :Gene4952_e1; affx:cdsType "Partial" ; affx:cdsStart "44399801" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4952_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4952_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4952_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4952_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4952_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4952_e7; affx:cdsType "Partial" ; affx:cdsStop "44415331" ; affx:frame "2"] ; . :Gene4952_e1 a affx:Exon ; affx:startsAt "44399283" ; affx:stopsAt "44399907" ; affx:commonToAll "1" . :Gene4952_e2 a affx:Exon ; affx:startsAt "44403071" ; affx:stopsAt "44403155" ; affx:commonToAll "1" . :Gene4952_e3 a affx:Exon ; affx:startsAt "44404513" ; affx:stopsAt "44404622" ; affx:commonToAll "1" . :Gene4952_e4 a affx:Exon ; affx:startsAt "44408665" ; affx:stopsAt "44408806" ; affx:commonToAll "1" . :Gene4952_e5 a affx:Exon ; affx:startsAt "44409875" ; affx:stopsAt "44409972" ; affx:commonToAll "1" . :Gene4952_e6 a affx:Exon ; affx:startsAt "44412804" ; affx:stopsAt "44412897" ; affx:commonToAll "1" . :Gene4952_e7 a affx:Exon ; affx:startsAt "44415235" ; affx:stopsAt "44415386" ; affx:commonToAll "1" . :Gene4953 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13097356] . :gi13097356 a affx:Transcript ; affx:unigene "iMm.28839" ; affx:translatesTo "MEDGELIEYFKSQMKGDPKMASAVAAIQTLLEFLKRDKGETLQGLRANLTYAIKTLCGVDSSVAVSSGGELFLRFISLTSLEYSDYSKCKKIMIERGELFLRRISLSRNKIANLCHTFIKDGARILTHAYSRVVLRVLEEAVAAKKRFSVYITESQPDLSGKKMAKALSHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQEDVPDKFKYKADTLKSVQTGQDLKEEHPWVDYTSPSLITLLFTDLGVLTPSAVSDELIKLYL" ; affx:hasCds [affx:startsAt "122670729" ; affx:stopsAt "122678553" ]; affx:hasExon [ affx:relatesToExon :Gene4953_e1; affx:cdsType "Partial" ; affx:cdsStart "122670729" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4953_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4953_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4953_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4953_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4953_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4953_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4953_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4953_e9; affx:cdsType "Partial" ; affx:cdsStop "122678553" ; affx:frame "0"] ; . :Gene4953_e1 a affx:Exon ; affx:startsAt "122670192" ; affx:stopsAt "122670894" ; affx:commonToAll "1" . :Gene4953_e2 a affx:Exon ; affx:startsAt "122671300" ; affx:stopsAt "122671426" ; affx:commonToAll "1" . :Gene4953_e3 a affx:Exon ; affx:startsAt "122672617" ; affx:stopsAt "122672693" ; affx:commonToAll "1" . :Gene4953_e4 a affx:Exon ; affx:startsAt "122673225" ; affx:stopsAt "122673294" ; affx:commonToAll "1" . :Gene4953_e5 a affx:Exon ; affx:startsAt "122674137" ; affx:stopsAt "122674250" ; affx:commonToAll "1" . :Gene4953_e6 a affx:Exon ; affx:startsAt "122676337" ; affx:stopsAt "122676454" ; affx:commonToAll "1" . :Gene4953_e7 a affx:Exon ; affx:startsAt "122676555" ; affx:stopsAt "122676692" ; affx:commonToAll "1" . :Gene4953_e8 a affx:Exon ; affx:startsAt "122677976" ; affx:stopsAt "122678078" ; affx:commonToAll "1" . :Gene4953_e9 a affx:Exon ; affx:startsAt "122678540" ; affx:stopsAt "122678585" ; affx:commonToAll "1" . :Gene4954 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13096815] . :gi13096815 a affx:Transcript ; affx:unigene "iMm.28934" ; affx:translatesTo "MTKPRLFRLWLVLGSALMILLIIVYWDNVGTAHFYLHTSLSRPHILEPLPTQGLVEENVFTSDVDEFLDTLLSSDAKHNDLSRRKTEQPPVPAPSKPVLSHMEENVRGYDWSTHDAHQNPDRDRQQAERRSLLRDFCANASLAFPTKDRSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSESLLDRGSPYRDPLDIPREHVHNTSTHLTFNKFWRRYGKFSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASVSEAFSAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAAQLLRFLKVDSQLHFPPSYRNRTASSWEEDWFANIPLAWRQQLYKLYEADFVLFGYPKPENLLRD" ; affx:hasCds [affx:startsAt "139424781" ; affx:stopsAt "139426041" ]; affx:hasExon [ affx:relatesToExon :Gene4954_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4954_e2; affx:cdsType "Partial" ; affx:cdsStart "139424781" ; affx:cdsStop "139426041" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "32" ; affx:spannedBy [ affx:startsAt "139424781" ; affx:stopsAt "139424877" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4954_e1 a affx:Exon ; affx:startsAt "139406360" ; affx:stopsAt "139406429" ; affx:commonToAll "1" . :Gene4954_e2 a affx:Exon ; affx:startsAt "139424702" ; affx:stopsAt "139426400" ; affx:commonToAll "1" . :Gene4955 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17391191] . :gi17391191 a affx:Transcript ; affx:unigene "iMm.28374" ; affx:translatesTo "MPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTALHLNDNNLARIPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNDNYLRVLPYELGRLFQLQTLGLTGNPLSQDIMSLYQDPDGTRKLLNFMLDNLAVHPEQLPPRPWITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNWDADIISLQEVETEQYFTLFLPALKDRGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGTGMKPIHAADKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGRITHGFQLKSAYENNLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELHPPLLPLVNGVHLPNRR" ; affx:hasCds [affx:startsAt "93581949" ; affx:stopsAt "93638987" ]; affx:hasExon [ affx:relatesToExon :Gene4955_e1; affx:cdsType "Partial" ; affx:cdsStart "93581949" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e11; affx:cdsType "Partial" ; affx:cdsStop "93638987" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4955_e12; affx:cdsType "None" ] ; . :Gene4955_e1 a affx:Exon ; affx:startsAt "93581553" ; affx:stopsAt "93582162" ; affx:commonToAll "1" . :Gene4955_e2 a affx:Exon ; affx:startsAt "93584702" ; affx:stopsAt "93584905" ; affx:commonToAll "1" . :Gene4955_e3 a affx:Exon ; affx:startsAt "93587639" ; affx:stopsAt "93587867" ; affx:commonToAll "1" . :Gene4955_e4 a affx:Exon ; affx:startsAt "93590911" ; affx:stopsAt "93591063" ; affx:commonToAll "1" . :Gene4955_e5 a affx:Exon ; affx:startsAt "93596353" ; affx:stopsAt "93596508" ; affx:commonToAll "1" . :Gene4955_e6 a affx:Exon ; affx:startsAt "93598911" ; affx:stopsAt "93599069" ; affx:commonToAll "1" . :Gene4955_e7 a affx:Exon ; affx:startsAt "93603127" ; affx:stopsAt "93603196" ; affx:commonToAll "1" . :Gene4955_e8 a affx:Exon ; affx:startsAt "93611098" ; affx:stopsAt "93611188" ; affx:commonToAll "1" . :Gene4955_e9 a affx:Exon ; affx:startsAt "93633807" ; affx:stopsAt "93633893" ; affx:commonToAll "1" . :Gene4955_e10 a affx:Exon ; affx:startsAt "93635923" ; affx:stopsAt "93636110" ; affx:commonToAll "1" . :Gene4955_e11 a affx:Exon ; affx:startsAt "93638875" ; affx:stopsAt "93638997" ; affx:commonToAll "1" . :Gene4955_e12 a affx:Exon ; affx:startsAt "93666892" ; affx:stopsAt "93666946" ; affx:commonToAll "1" . :Gene4956 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17160983] . :gi17160983 a affx:Transcript ; affx:unigene "iMm.37819" ; affx:translatesTo "MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSMYLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNNLQTKVDLLEKSNTKLTEELAVANNRIITLQEEMERVKEESSYLLESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVEKELELQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH" ; affx:hasCds [affx:startsAt "88190925" ; affx:stopsAt "88247231" ]; affx:hasExon [ affx:relatesToExon :Gene4956_e1; affx:cdsType "Partial" ; affx:cdsStart "88190925" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4956_e13; affx:cdsType "Partial" ; affx:cdsStop "88247231" ; affx:frame "1"] ; . :Gene4956_e1 a affx:Exon ; affx:startsAt "88190909" ; affx:stopsAt "88191103" ; affx:commonToAll "1" . :Gene4956_e2 a affx:Exon ; affx:startsAt "88221266" ; affx:stopsAt "88221440" ; affx:commonToAll "1" . :Gene4956_e3 a affx:Exon ; affx:startsAt "88222787" ; affx:stopsAt "88222905" ; affx:commonToAll "1" . :Gene4956_e4 a affx:Exon ; affx:startsAt "88223660" ; affx:stopsAt "88223762" ; affx:commonToAll "1" . :Gene4956_e5 a affx:Exon ; affx:startsAt "88227632" ; affx:stopsAt "88227756" ; affx:commonToAll "1" . :Gene4956_e6 a affx:Exon ; affx:startsAt "88233583" ; affx:stopsAt "88233645" ; affx:commonToAll "1" . :Gene4956_e7 a affx:Exon ; affx:startsAt "88234387" ; affx:stopsAt "88234453" ; affx:commonToAll "1" . :Gene4956_e8 a affx:Exon ; affx:startsAt "88236899" ; affx:stopsAt "88236969" ; affx:commonToAll "1" . :Gene4956_e9 a affx:Exon ; affx:startsAt "88238801" ; affx:stopsAt "88238894" ; affx:commonToAll "1" . :Gene4956_e10 a affx:Exon ; affx:startsAt "88241761" ; affx:stopsAt "88241845" ; affx:commonToAll "1" . :Gene4956_e11 a affx:Exon ; affx:startsAt "88243761" ; affx:stopsAt "88243929" ; affx:commonToAll "1" . :Gene4956_e12 a affx:Exon ; affx:startsAt "88245550" ; affx:stopsAt "88245648" ; affx:commonToAll "1" . :Gene4956_e13 a affx:Exon ; affx:startsAt "88247158" ; affx:stopsAt "88248185" ; affx:commonToAll "1" . :Gene4957 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17028403] . :gi17028403 a affx:Transcript ; affx:unigene "iMm.50610" ; affx:translatesTo "MSRMWGHLSEGYGQLCSIYLKLLRTRMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNLFQTVFNSLDMSRSVSVTTAGQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFQRSSNLQYFKRLIQIPQLPENPPNFLRASALSEHISPVVVIPAEVSSPDSEPVLEKDDLMDMDASQQTLFDNKFDDVFGSSLSSDPFNFNNQNGVNKDEKDHLIERLYREISGLTGQLDNMKIESQRAMLQLKGRVSELEAELAEQQHLGRQAMDDCEFLRTELDELKRQREDTEKAQRSLTEIERKAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSVARQAQVDLEREKKELADSFARTQEQQDVLENLKHELATSRQELQVLHSNLETSAQSEAKWLTQIAELEKEQGSLATVAAQREEELSALRDQLESTQIKLAGAQESMCQQVKDQRKTLLAGIRKAAEREIQEALSQLEEPTLISCAGSTDHLLSKVSSVSSCLEQLEKNGSQYLACPEDISELLHSITLLAHLTGDTIIQGSATSLRAPPEPADSLTEACRQYGRETLAYLSSLEEEGTMENADVTALRNCLSRVKTLGEELLPRGLDIKQEELGDLVDKEMAATSAAIEAATTRIEEILSKSRAGDTGVKLEVNERILGSCTSLMQAIKVLVVASKDLQKEIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATIMVDAADLVVQGKGKFEELMVCSREIAASTAQLVAASKVKANKGSLNLTQLQQASRGVNQATAAVVASTISGKSQIEETDSMDFSSMTLTQIKRQEMDSQVRVLELENDLQKERQKLGELRKKHYELAGVAEGWEEGTEASPSTVQEAIPDKE" ; affx:hasCds [affx:startsAt "134014111" ; affx:stopsAt "134059948" ]; affx:hasExon [ affx:relatesToExon :Gene4957_e1; affx:cdsType "Partial" ; affx:cdsStart "134014111" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e20; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e21; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e22; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e24; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e25; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e26; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e27; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e28; affx:cdsType "Partial" ; affx:cdsStop "134059948" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4957_e29; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4957_e30; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4957_e31; affx:cdsType "None" ] ; . :Gene4957_e1 a affx:Exon ; affx:startsAt "134010920" ; affx:stopsAt "134014164" ; affx:commonToAll "1" . :Gene4957_e2 a affx:Exon ; affx:startsAt "134015505" ; affx:stopsAt "134015614" ; affx:commonToAll "1" . :Gene4957_e3 a affx:Exon ; affx:startsAt "134017144" ; affx:stopsAt "134017206" ; affx:commonToAll "1" . :Gene4957_e4 a affx:Exon ; affx:startsAt "134019864" ; affx:stopsAt "134019988" ; affx:commonToAll "1" . :Gene4957_e5 a affx:Exon ; affx:startsAt "134023118" ; affx:stopsAt "134023224" ; affx:commonToAll "1" . :Gene4957_e6 a affx:Exon ; affx:startsAt "134025015" ; affx:stopsAt "134025116" ; affx:commonToAll "1" . :Gene4957_e7 a affx:Exon ; affx:startsAt "134027436" ; affx:stopsAt "134027530" ; affx:commonToAll "1" . :Gene4957_e8 a affx:Exon ; affx:startsAt "134027759" ; affx:stopsAt "134027818" ; affx:commonToAll "1" . :Gene4957_e9 a affx:Exon ; affx:startsAt "134029215" ; affx:stopsAt "134029326" ; affx:commonToAll "1" . :Gene4957_e10 a affx:Exon ; affx:startsAt "134031394" ; affx:stopsAt "134031531" ; affx:commonToAll "1" . :Gene4957_e11 a affx:Exon ; affx:startsAt "134031611" ; affx:stopsAt "134031719" ; affx:commonToAll "1" . :Gene4957_e12 a affx:Exon ; affx:startsAt "134032068" ; affx:stopsAt "134032155" ; affx:commonToAll "1" . :Gene4957_e13 a affx:Exon ; affx:startsAt "134033085" ; affx:stopsAt "134033221" ; affx:commonToAll "1" . :Gene4957_e14 a affx:Exon ; affx:startsAt "134034178" ; affx:stopsAt "134034322" ; affx:commonToAll "1" . :Gene4957_e15 a affx:Exon ; affx:startsAt "134034540" ; affx:stopsAt "134034642" ; affx:commonToAll "1" . :Gene4957_e16 a affx:Exon ; affx:startsAt "134035944" ; affx:stopsAt "134036037" ; affx:commonToAll "1" . :Gene4957_e17 a affx:Exon ; affx:startsAt "134037135" ; affx:stopsAt "134037224" ; affx:commonToAll "1" . :Gene4957_e18 a affx:Exon ; affx:startsAt "134037901" ; affx:stopsAt "134038085" ; affx:commonToAll "1" . :Gene4957_e19 a affx:Exon ; affx:startsAt "134039331" ; affx:stopsAt "134039404" ; affx:commonToAll "1" . :Gene4957_e20 a affx:Exon ; affx:startsAt "134041429" ; affx:stopsAt "134041527" ; affx:commonToAll "1" . :Gene4957_e21 a affx:Exon ; affx:startsAt "134042916" ; affx:stopsAt "134043057" ; affx:commonToAll "1" . :Gene4957_e22 a affx:Exon ; affx:startsAt "134043143" ; affx:stopsAt "134043219" ; affx:commonToAll "1" . :Gene4957_e23 a affx:Exon ; affx:startsAt "134047629" ; affx:stopsAt "134047687" ; affx:commonToAll "1" . :Gene4957_e24 a affx:Exon ; affx:startsAt "134052578" ; affx:stopsAt "134052719" ; affx:commonToAll "1" . :Gene4957_e25 a affx:Exon ; affx:startsAt "134054468" ; affx:stopsAt "134054530" ; affx:commonToAll "1" . :Gene4957_e26 a affx:Exon ; affx:startsAt "134055694" ; affx:stopsAt "134055771" ; affx:commonToAll "1" . :Gene4957_e27 a affx:Exon ; affx:startsAt "134057959" ; affx:stopsAt "134058040" ; affx:commonToAll "1" . :Gene4957_e28 a affx:Exon ; affx:startsAt "134059933" ; affx:stopsAt "134059990" ; affx:commonToAll "1" . :Gene4957_e29 a affx:Exon ; affx:startsAt "134060994" ; affx:stopsAt "134061137" ; affx:commonToAll "1" . :Gene4957_e30 a affx:Exon ; affx:startsAt "134063301" ; affx:stopsAt "134063365" ; affx:commonToAll "1" . :Gene4957_e31 a affx:Exon ; affx:startsAt "134147831" ; affx:stopsAt "134148010" ; affx:commonToAll "1" . :Gene4958 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17512372] . :gi17512372 a affx:Transcript ; affx:unigene "iMm.159924" ; affx:translatesTo "MTPVFLLGNVNECFHNFSESHRCILMHSPPSATPEPLPSTNTSVCSTLYFYGVTIFLASFFFSFLTIMVLLVHAQMLYKKFVKSTGLLESEQWAVIHTVGQRVRFFPVAFVCCWGPAVTLLIMKLTEPQETFLHMALSVLQALTAASQGLLNCGIYGWTQCKFQQIKREPHRDADTQTPLLCSQKRIYSRSPNLLESPLALASSSSTVL" ; affx:hasCds [affx:startsAt "119552558" ; affx:stopsAt "119558486" ]; affx:hasExon [ affx:relatesToExon :Gene4958_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4958_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4958_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4958_e4; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4958_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4958_e6; affx:cdsType "Partial" ; affx:cdsStart "119552558" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4958_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4958_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4958_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4958_e10; affx:cdsType "Partial" ; affx:cdsStop "119558486" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "50" ; affx:stopsAt "72" ; affx:spannedBy [ affx:startsAt "119554452" ; affx:stopsAt "119554506" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "119556922" ; affx:stopsAt "119556934" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "105" ; affx:stopsAt "122" ; affx:spannedBy [ affx:startsAt "119557033" ; affx:stopsAt "119557067" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "119557495" ; affx:stopsAt "119557512" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "137" ; affx:stopsAt "159" ; affx:spannedBy [ affx:startsAt "119557557" ; affx:stopsAt "119557569" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "119558279" ; affx:stopsAt "119558333" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4958_e1 a affx:Exon ; affx:startsAt "119526418" ; affx:stopsAt "119526492" ; affx:commonToAll "1" . :Gene4958_e2 a affx:Exon ; affx:startsAt "119527008" ; affx:stopsAt "119527055" ; affx:commonToAll "1" . :Gene4958_e3 a affx:Exon ; affx:startsAt "119528020" ; affx:stopsAt "119528084" ; affx:commonToAll "1" . :Gene4958_e4 a affx:Exon ; affx:startsAt "119531075" ; affx:stopsAt "119531207" ; affx:commonToAll "1" . :Gene4958_e5 a affx:Exon ; affx:startsAt "119551041" ; affx:stopsAt "119551091" ; affx:commonToAll "1" . :Gene4958_e6 a affx:Exon ; affx:startsAt "119552539" ; affx:stopsAt "119552623" ; affx:commonToAll "1" . :Gene4958_e7 a affx:Exon ; affx:startsAt "119554367" ; affx:stopsAt "119554506" ; affx:commonToAll "1" . :Gene4958_e8 a affx:Exon ; affx:startsAt "119556922" ; affx:stopsAt "119557067" ; affx:commonToAll "1" . :Gene4958_e9 a affx:Exon ; affx:startsAt "119557495" ; affx:stopsAt "119557569" ; affx:commonToAll "1" . :Gene4958_e10 a affx:Exon ; affx:startsAt "119558279" ; affx:stopsAt "119558713" ; affx:commonToAll "1" . :Gene4959 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi16877852] . :gi16877852 a affx:Transcript ; affx:unigene "iMm.29604" ; affx:translatesTo "MVGLDIDPRLIHSARQNIRHYLSEELRLQAQTSEGDPGTEGEEGTITVRKRSCFPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDELVDAQRPEYDVVLCFSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYCKRKSLTETIYKNYFRIQLKPEQFSSYLTSPEVGFSSYELVATPNNTSRGFQRPVYLFHKARSPSH" ; affx:hasCds [affx:startsAt "136498514" ; affx:stopsAt "136500807" ]; affx:hasExon [ affx:relatesToExon :Gene4959_e1; affx:cdsType "Partial" ; affx:cdsStart "136498514" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4959_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4959_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4959_e4; affx:cdsType "Partial" ; affx:cdsStop "136500807" ; affx:frame "2"] ; . :Gene4959_e1 a affx:Exon ; affx:startsAt "136497988" ; affx:stopsAt "136498567" ; affx:commonToAll "1" . :Gene4959_e2 a affx:Exon ; affx:startsAt "136498677" ; affx:stopsAt "136498804" ; affx:commonToAll "1" . :Gene4959_e3 a affx:Exon ; affx:startsAt "136499212" ; affx:stopsAt "136499431" ; affx:commonToAll "1" . :Gene4959_e4 a affx:Exon ; affx:startsAt "136500543" ; affx:stopsAt "136501041" ; affx:commonToAll "1" . :Gene4960 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17390839] . :gi17390839 a affx:Transcript ; affx:unigene "iMm.28435" ; affx:translatesTo "MAAPGPASRFWCSCPEVPSATFFTALLSLLVSGPRLFLLQPPLAPSGLSLRSEALRNWQVYRLVTYIFVYENPVSLLCGAIIIWRFAGNFERTVGTVRHCFFTLIFTVFSAIIYLSFESVSSLSKLGEVEDARGFTPVAFAMLGVTSVRSRMRRALVFGVVVPSVLVPWLLLCASWLIPQTSFLSNVSGLLIGLSYGLTYCYSLDLSERVALKLDQKFPFSLMRRIPLFKYISGSSAERRAAQSRRLNPAPGSYPTQSCHPHLTPSYPVTQMQHASGQKLASWPPGHMPSLPPYQPASGLCYVQNHFGPNPNASSVYPASAGTSQGVQPPSPISCPGTVYSGALGTPGATGSKESSKVAMP" ; affx:hasCds [affx:startsAt "134235635" ; affx:stopsAt "134246273" ]; affx:hasExon [ affx:relatesToExon :Gene4960_e1; affx:cdsType "Partial" ; affx:cdsStart "134235635" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4960_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4960_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4960_e4; affx:cdsType "Partial" ; affx:cdsStop "134246273" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "39" ; affx:spannedBy [ affx:startsAt "134235635" ; affx:stopsAt "134235752" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "66" ; affx:stopsAt "88" ; affx:spannedBy [ affx:startsAt "134238909" ; affx:stopsAt "134238975" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "95" ; affx:stopsAt "117" ; affx:spannedBy [ affx:startsAt "134238996" ; affx:stopsAt "134239062" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "132" ; affx:stopsAt "149" ; affx:spannedBy [ affx:startsAt "134239107" ; affx:stopsAt "134239158" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "156" ; affx:stopsAt "178" ; affx:spannedBy [ affx:startsAt "134239179" ; affx:stopsAt "134239245" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "182" ; affx:stopsAt "204" ; affx:spannedBy [ affx:startsAt "134239257" ; affx:stopsAt "134239297" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "134241984" ; affx:stopsAt "134242010" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4960_e1 a affx:Exon ; affx:startsAt "134235616" ; affx:stopsAt "134235813" ; affx:commonToAll "1" . :Gene4960_e2 a affx:Exon ; affx:startsAt "134238889" ; affx:stopsAt "134239297" ; affx:commonToAll "1" . :Gene4960_e3 a affx:Exon ; affx:startsAt "134241984" ; affx:stopsAt "134242135" ; affx:commonToAll "1" . :Gene4960_e4 a affx:Exon ; affx:startsAt "134245924" ; affx:stopsAt "134247041" ; affx:commonToAll "1" . :Gene4961 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17391133] . :gi17391133 a affx:Transcript ; affx:unigene "iMm.29409" ; affx:translatesTo "MQRSECSGGVQLRNRATGSNDQRTSSSTQMKHRTTVQRSKSSSLTSSPEAARRARPRPSDKLNPKTINPFGEQPRAPTAFAAIYSQGGIPCRLVHGSVKHRLQWECPPEILPFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEVFERGLSALVQLSVVVGPSLNGHLKLLLTSLSKRLMDKKFKEPITSALQKLEQHGGNASLIIIKSKIPTYCSICC" ; affx:hasCds [affx:startsAt "47372618" ; affx:stopsAt "47386585" ]; affx:hasExon [ affx:relatesToExon :Gene4961_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4961_e2; affx:cdsType "Partial" ; affx:cdsStart "47372618" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4961_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4961_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4961_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4961_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4961_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4961_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4961_e9; affx:cdsType "Partial" ; affx:cdsStop "47386585" ; affx:frame "1"] ; . :Gene4961_e1 a affx:Exon ; affx:startsAt "47370814" ; affx:stopsAt "47370918" ; affx:commonToAll "1" . :Gene4961_e2 a affx:Exon ; affx:startsAt "47372602" ; affx:stopsAt "47372670" ; affx:commonToAll "1" . :Gene4961_e3 a affx:Exon ; affx:startsAt "47372806" ; affx:stopsAt "47372961" ; affx:commonToAll "1" . :Gene4961_e4 a affx:Exon ; affx:startsAt "47373965" ; affx:stopsAt "47374033" ; affx:commonToAll "1" . :Gene4961_e5 a affx:Exon ; affx:startsAt "47375496" ; affx:stopsAt "47375587" ; affx:commonToAll "1" . :Gene4961_e6 a affx:Exon ; affx:startsAt "47377754" ; affx:stopsAt "47377889" ; affx:commonToAll "1" . :Gene4961_e7 a affx:Exon ; affx:startsAt "47378548" ; affx:stopsAt "47378656" ; affx:commonToAll "1" . :Gene4961_e8 a affx:Exon ; affx:startsAt "47380211" ; affx:stopsAt "47380292" ; affx:commonToAll "1" . :Gene4961_e9 a affx:Exon ; affx:startsAt "47386528" ; affx:stopsAt "47387178" ; affx:commonToAll "1" . :Gene4962 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18605688] . :gi18605688 a affx:Transcript ; affx:unigene "iMm.196365" ; affx:translatesTo "MVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAPGPANISGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWSEPFHSKSSSSRFLEV" ; affx:hasCds [affx:startsAt "113054521" ; affx:stopsAt "113062908" ]; affx:hasExon [ affx:relatesToExon :Gene4962_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4962_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4962_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4962_e4; affx:cdsType "Partial" ; affx:cdsStart "113054521" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4962_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4962_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4962_e7; affx:cdsType "Partial" ; affx:cdsStop "113062908" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "46" ; affx:stopsAt "68" ; affx:spannedBy [ affx:startsAt "113060771" ; affx:stopsAt "113060837" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "97" ; affx:stopsAt "119" ; affx:spannedBy [ affx:startsAt "113060924" ; affx:stopsAt "113060961" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "113061556" ; affx:stopsAt "113061585" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "123" ; affx:stopsAt "145" ; affx:spannedBy [ affx:startsAt "113061597" ; affx:stopsAt "113061663" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4962_e1 a affx:Exon ; affx:startsAt "113049093" ; affx:stopsAt "113049166" ; affx:commonToAll "1" . :Gene4962_e2 a affx:Exon ; affx:startsAt "113050515" ; affx:stopsAt "113050628" ; affx:commonToAll "1" . :Gene4962_e3 a affx:Exon ; affx:startsAt "113053952" ; affx:stopsAt "113054059" ; affx:commonToAll "1" . :Gene4962_e4 a affx:Exon ; affx:startsAt "113054485" ; affx:stopsAt "113054649" ; affx:commonToAll "1" . :Gene4962_e5 a affx:Exon ; affx:startsAt "113060761" ; affx:stopsAt "113060961" ; affx:commonToAll "1" . :Gene4962_e6 a affx:Exon ; affx:startsAt "113061556" ; affx:stopsAt "113061666" ; affx:commonToAll "1" . :Gene4962_e7 a affx:Exon ; affx:startsAt "113062836" ; affx:stopsAt "113064501" ; affx:commonToAll "1" . :Gene4963 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18256899] . :gi18256899 a affx:Transcript ; affx:unigene "iMm.216305" ; affx:translatesTo "MASVAGDSAMEVVPALAEEAAAEATGPSCLVQLPGEVLEYILCSGSLPALDIGRVSSTCRRLREVCQSSGQVWPEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFSEHVPCNGFSDIENLEGPEIFFEDELVCILNMEGRKALTWKYYAKKILYYLRQQKILNNLKAFLQQPDDYESYLEGAVYIDQYCNPLSDISFRDIQAQIHSIVELVCKTLRGINSQHPSLTFRAGESSMIMEIELQSQVLDAINYVLYDQLKFKGNRMDYYNALNLYMHQVLTRRTGIPISMSLLYLTVARQLGVPLEPVNFPSHFLLRWCQGAEGATLDIFDYIYIDAFGKGKQLTVKECEYLIGQHVTAALYGVVNVKKVLQRMVGNLLSLGKREGIDQSYQLLRDSLDLYLAMYPDQVQLLLLQARLYFHLGIWPEKSFCLVLKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSEEKHRDVCYSIGLVMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPEDLEFVYETVQNIYSAKEDTAE" ; affx:hasCds [affx:startsAt "115975147" ; affx:stopsAt "116006208" ]; affx:hasExon [ affx:relatesToExon :Gene4963_e1; affx:cdsType "Partial" ; affx:cdsStart "115975147" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4963_e12; affx:cdsType "Partial" ; affx:cdsStop "116006208" ; affx:frame "1"] ; . :Gene4963_e1 a affx:Exon ; affx:startsAt "115975079" ; affx:stopsAt "115975386" ; affx:commonToAll "1" . :Gene4963_e2 a affx:Exon ; affx:startsAt "115976204" ; affx:stopsAt "115976340" ; affx:commonToAll "1" . :Gene4963_e3 a affx:Exon ; affx:startsAt "115978087" ; affx:stopsAt "115978182" ; affx:commonToAll "1" . :Gene4963_e4 a affx:Exon ; affx:startsAt "115984108" ; affx:stopsAt "115984230" ; affx:commonToAll "1" . :Gene4963_e5 a affx:Exon ; affx:startsAt "115986787" ; affx:stopsAt "115986934" ; affx:commonToAll "1" . :Gene4963_e6 a affx:Exon ; affx:startsAt "115987133" ; affx:stopsAt "115987270" ; affx:commonToAll "1" . :Gene4963_e7 a affx:Exon ; affx:startsAt "115988813" ; affx:stopsAt "115988950" ; affx:commonToAll "1" . :Gene4963_e8 a affx:Exon ; affx:startsAt "115992492" ; affx:stopsAt "115992672" ; affx:commonToAll "1" . :Gene4963_e9 a affx:Exon ; affx:startsAt "115993380" ; affx:stopsAt "115993513" ; affx:commonToAll "1" . :Gene4963_e10 a affx:Exon ; affx:startsAt "115998327" ; affx:stopsAt "115998539" ; affx:commonToAll "1" . :Gene4963_e11 a affx:Exon ; affx:startsAt "116000025" ; affx:stopsAt "116000183" ; affx:commonToAll "1" . :Gene4963_e12 a affx:Exon ; affx:startsAt "116006020" ; affx:stopsAt "116006699" ; affx:commonToAll "1" . :Gene4964 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18490962] . :gi18490962 a affx:Transcript ; affx:unigene "iMm.35514" ; affx:translatesTo "MVRLMDCDPWKLSQSGRKKQDYGPKVNFRKQKLKMAGFQGLPGFSQKVVQRMGLYPGLEDFQPVEQCNLDYSPERGSAIDPHLDDAWLWGERLVSLNLLSATVVSMSPEAPGSLLLCSAPSVRPDAFEDSLVAPSRSVPCQEVEVAITVPRRSLLVLTGAARHQWTHAIHRRHIKARRVCATFRELSSEFLPGGKQQELGQELLQAALSFQGRPV" ; affx:hasCds [affx:startsAt "134755115" ; affx:stopsAt "134756406" ]; affx:hasExon [ affx:relatesToExon :Gene4964_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4964_e2; affx:cdsType "Partial" ; affx:cdsStart "134755115" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4964_e3; affx:cdsType "Partial" ; affx:cdsStop "134756406" ; affx:frame "1"] ; . :Gene4964_e1 a affx:Exon ; affx:startsAt "134754420" ; affx:stopsAt "134754623" ; affx:commonToAll "1" . :Gene4964_e2 a affx:Exon ; affx:startsAt "134755101" ; affx:stopsAt "134755175" ; affx:commonToAll "1" . :Gene4964_e3 a affx:Exon ; affx:startsAt "134755818" ; affx:stopsAt "134757255" ; affx:commonToAll "1" . :Gene4965 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18256162] . :gi18256162 a affx:Transcript ; affx:unigene "iMm.215254" ; affx:translatesTo "MIKPRLLTEAIALLTSNQEEVTFSVTPGNFCLKSLSGELLDLTSSVYSEMSFGPEEFDFFQVGLDTEITFCFKELKGILTFSEVMHAPLAIYFDFPGKPVVLSVEDMLLEANFILATLVDYPSRTSSPQLLPLSQARRSHPIQSSAPEDKSRVSQTPESISRAAPKRLFPKDSPDSSSAAETKRASAGQDDIFEVPESVVSDMEEERSPSHLRKFSCMFFGAVSCEQQEYAGHPLDSLAVASDSEEDVSG" ; affx:hasCds [affx:startsAt "120396560" ; affx:stopsAt "120414904" ]; affx:hasExon [ affx:relatesToExon :Gene4965_e1; affx:cdsType "Partial" ; affx:cdsStart "120396560" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4965_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4965_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4965_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4965_e5; affx:cdsType "Partial" ; affx:cdsStop "120405128" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4965_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4965_e7; affx:cdsType "Partial" ; affx:cdsStop "120414904" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4965_e8; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4965_e9; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4965_e10; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4965_e11; affx:cdsType "None" ] ; . :Gene4965_e1 a affx:Exon ; affx:startsAt "120396199" ; affx:stopsAt "120396671" ; affx:commonToAll "1" . :Gene4965_e2 a affx:Exon ; affx:startsAt "120402160" ; affx:stopsAt "120402389" ; affx:commonToAll "1" . :Gene4965_e3 a affx:Exon ; affx:startsAt "120403987" ; affx:stopsAt "120404107" ; affx:commonToAll "1" . :Gene4965_e4 a affx:Exon ; affx:startsAt "120404953" ; affx:stopsAt "120405018" ; affx:commonToAll "1" . :Gene4965_e5 a affx:Exon ; affx:startsAt "120405101" ; affx:stopsAt "120405209" ; affx:commonToAll "1" . :Gene4965_e6 a affx:Exon ; affx:startsAt "120410424" ; affx:stopsAt "120410531" ; affx:commonToAll "1" . :Gene4965_e7 a affx:Exon ; affx:startsAt "120414890" ; affx:stopsAt "120414990" ; affx:commonToAll "1" . :Gene4965_e8 a affx:Exon ; affx:startsAt "120421952" ; affx:stopsAt "120422067" ; affx:commonToAll "1" . :Gene4965_e9 a affx:Exon ; affx:startsAt "120422254" ; affx:stopsAt "120422404" ; affx:commonToAll "1" . :Gene4965_e10 a affx:Exon ; affx:startsAt "120423237" ; affx:stopsAt "120423308" ; affx:commonToAll "1" . :Gene4965_e11 a affx:Exon ; affx:startsAt "120424832" ; affx:stopsAt "120424889" ; affx:commonToAll "1" . :Gene4966 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18257343] . :gi18257343 a affx:Transcript ; affx:unigene "iMm.45742" ; affx:translatesTo "MWSRAASVRFRAPLDAGRSFASKANPQGKVQAAGLGTQAPRLVPQGSGRVSPAVIEHLERLALVNFGSREAVDRLEKAIAFADQLHAVDTDGVEPLESVLEDRCLYLRSDNVAEGSCAEELLQNSNHVVEEYFVAPPGNISLPDMVNKIPSSTAE" ; affx:hasCds [affx:startsAt "113302762" ; affx:stopsAt "113309373" ]; affx:hasExon [ affx:relatesToExon :Gene4966_e1; affx:cdsType "Partial" ; affx:cdsStart "113302762" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4966_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4966_e3; affx:cdsType "Partial" ; affx:cdsStop "113309373" ; affx:frame "1"] ; . :Gene4966_e1 a affx:Exon ; affx:startsAt "113301472" ; affx:stopsAt "113302818" ; affx:commonToAll "1" . :Gene4966_e2 a affx:Exon ; affx:startsAt "113303690" ; affx:stopsAt "113303794" ; affx:commonToAll "1" . :Gene4966_e3 a affx:Exon ; affx:startsAt "113309065" ; affx:stopsAt "113309378" ; affx:commonToAll "1" . :Gene4967 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18381137] . :gi18381137 a affx:Transcript ; affx:unigene "iMm.18004" ; affx:translatesTo "MDASPEPQQKGGTLVLVRRQPPVSQGLLETLKARLKKSCTCSMPCAQALVQGLFPAIHWLPQYRLKEYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRHVNVGIFSLLCLMVGQVVDRELQLAGFDPSQDSLGPKNNDSTLNNSATTLIIGLQDCRRDCYAIRVATALTLMAGLYQVLMGILRLGFVSTYLSQPLLDGFAMGASVTILTSQAKHMLGVQIPRHQGLGMVVHTWLSLLQNVGQANICDVVTSALCLGVLLAAKELSDRYRHRLKVPIPTELFVIVVATIVSHFGQLHTRFDSRVAGNIPTGFVAPQVPDPKIMWRVALDAMSLALVGSAFSISLAEMFARSHGYSVSANQELLAVGCCNVLPAFFHCFATSAALSKTLVKIATGCQTQLSSVVSAAVVLLVLLVLAPLFHDLQRCVLACIIVVSLRGALRKVKDLPQLWRLSPADALVWVATAATCVLVSTEAGLLAGVFFSLLSLAGRTQRPRAALLARIGDSTFYEDAAEFEGLLPPPEVRVFRFTGPLYYANKDFFLRSLYRLTGLDAGHSATRKDQGPEVGVSNRSLVDGKDLGSVSSGAGLVVPLAFGFHTVVIDCAPLLFLDVAGMATLKDLRRDYRALDITLLLACCSPSVRDTLRKGGFLGEEQGAENELLFPSVHSAVEAACARREELLAADSAL" ; affx:hasCds [affx:startsAt "106350550" ; affx:stopsAt "106353355" ]; affx:hasExon [ affx:relatesToExon :Gene4967_e1; affx:cdsType "Partial" ; affx:cdsStart "106350550" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4967_e2; affx:cdsType "Partial" ; affx:cdsStop "106353355" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4967_e3; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "9" ; affx:containsMotif [ affx:startsAt "68" ; affx:stopsAt "90" ; affx:spannedBy [ affx:startsAt "106353085" ; affx:stopsAt "106353151" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "94" ; affx:stopsAt "116" ; affx:spannedBy [ affx:startsAt "106353007" ; affx:stopsAt "106353073" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "185" ; affx:stopsAt "207" ; affx:spannedBy [ affx:startsAt "106352764" ; affx:stopsAt "106352800" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "106352044" ; affx:stopsAt "106352074" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "260" ; affx:stopsAt "282" ; affx:spannedBy [ affx:startsAt "106351819" ; affx:stopsAt "106351885" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "295" ; affx:stopsAt "314" ; affx:spannedBy [ affx:startsAt "106351723" ; affx:stopsAt "106351780" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "347" ; affx:stopsAt "369" ; affx:spannedBy [ affx:startsAt "106351558" ; affx:stopsAt "106351624" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "382" ; affx:stopsAt "404" ; affx:spannedBy [ affx:startsAt "106351453" ; affx:stopsAt "106351519" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "417" ; affx:stopsAt "439" ; affx:spannedBy [ affx:startsAt "106351348" ; affx:stopsAt "106351414" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "477" ; affx:stopsAt "499" ; affx:spannedBy [ affx:startsAt "106351168" ; affx:stopsAt "106351234" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4967_e1 a affx:Exon ; affx:startsAt "106349868" ; affx:stopsAt "106352074" ; affx:commonToAll "1" . :Gene4967_e2 a affx:Exon ; affx:startsAt "106352764" ; affx:stopsAt "106353382" ; affx:commonToAll "1" . :Gene4967_e3 a affx:Exon ; affx:startsAt "106354572" ; affx:stopsAt "106354672" ; affx:commonToAll "1" . :Gene4968 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18204484] . :gi18204484 a affx:Transcript ; affx:unigene "iMm.41483" ; affx:translatesTo "MAATNLENQLHSAQKNLLFLQREHASTLKGLHAEIRRLQQHCTDLTYELTLKSFELTGDSSSRTTELKRRCEELEAQLKAKEEENRKLLQELEQKNAAIAVLENTVREREKKYLEELKVKSHKLSMLSGELEQRASTVAYLTSQLHAAKKKLLSSSGTSDASPAGSPALASYKPTPPKDKLPETPRRRMKKSLSAPLHPEFEEVYRFGAESRKLLLREPVDAMPDPTPFLLARESAEVQLKERPLVIPPIASDRSATGQHSPARDKPHKTHVGVAHRIHHATPSQAQPEGEMRAVDQVNASKVVRKHSGTDRTV" ; affx:hasCds [affx:startsAt "123073443" ; affx:stopsAt "123077719" ]; affx:hasExon [ affx:relatesToExon :Gene4968_e1; affx:cdsType "Partial" ; affx:cdsStart "123073443" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4968_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4968_e3; affx:cdsType "Partial" ; affx:cdsStop "123077719" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4968_e4; affx:cdsType "None" ] ; . :Gene4968_e1 a affx:Exon ; affx:startsAt "123072903" ; affx:stopsAt "123074216" ; affx:commonToAll "1" . :Gene4968_e2 a affx:Exon ; affx:startsAt "123076867" ; affx:stopsAt "123076909" ; affx:commonToAll "1" . :Gene4968_e3 a affx:Exon ; affx:startsAt "123077589" ; affx:stopsAt "123077736" ; affx:commonToAll "1" . :Gene4968_e4 a affx:Exon ; affx:startsAt "123099945" ; affx:stopsAt "123100085" ; affx:commonToAll "1" . :Gene4969 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18606333] . :gi18606333 a affx:Transcript ; affx:unigene "iMm.87620" ; affx:translatesTo "MSSCVSSQPTSDRVAPQDELGSGGGSREGQKPCEALRGLSSLSIHLGMESFIVVTECEPGRGVDLNLARDQPPEADGQELPLEASDPESRSPLSGRKMSLQEPSQGGPASSSNSLDMNGRCICPSLSYSPASSPQSSPRMPRRPTVESHHVSITGLQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGARPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKQGSEDSPRGPEPAPVGEEEVLL" ; affx:hasCds [affx:startsAt "120808404" ; affx:stopsAt "120838652" ]; affx:hasExon [ affx:relatesToExon :Gene4969_e1; affx:cdsType "Partial" ; affx:cdsStart "120808404" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4969_e15; affx:cdsType "Partial" ; affx:cdsStop "120838652" ; affx:frame "2"] ; . :Gene4969_e1 a affx:Exon ; affx:startsAt "120807419" ; affx:stopsAt "120808477" ; affx:commonToAll "1" . :Gene4969_e2 a affx:Exon ; affx:startsAt "120811664" ; affx:stopsAt "120811765" ; affx:commonToAll "1" . :Gene4969_e3 a affx:Exon ; affx:startsAt "120816331" ; affx:stopsAt "120816460" ; affx:commonToAll "1" . :Gene4969_e4 a affx:Exon ; affx:startsAt "120818101" ; affx:stopsAt "120818189" ; affx:commonToAll "1" . :Gene4969_e5 a affx:Exon ; affx:startsAt "120818289" ; affx:stopsAt "120818363" ; affx:commonToAll "1" . :Gene4969_e6 a affx:Exon ; affx:startsAt "120819939" ; affx:stopsAt "120819993" ; affx:commonToAll "1" . :Gene4969_e7 a affx:Exon ; affx:startsAt "120820481" ; affx:stopsAt "120820681" ; affx:commonToAll "1" . :Gene4969_e8 a affx:Exon ; affx:startsAt "120822185" ; affx:stopsAt "120822274" ; affx:commonToAll "1" . :Gene4969_e9 a affx:Exon ; affx:startsAt "120822409" ; affx:stopsAt "120822431" ; affx:commonToAll "1" . :Gene4969_e10 a affx:Exon ; affx:startsAt "120824246" ; affx:stopsAt "120824283" ; affx:commonToAll "1" . :Gene4969_e11 a affx:Exon ; affx:startsAt "120828015" ; affx:stopsAt "120828149" ; affx:commonToAll "1" . :Gene4969_e12 a affx:Exon ; affx:startsAt "120830919" ; affx:stopsAt "120830971" ; affx:commonToAll "1" . :Gene4969_e13 a affx:Exon ; affx:startsAt "120831876" ; affx:stopsAt "120831930" ; affx:commonToAll "1" . :Gene4969_e14 a affx:Exon ; affx:startsAt "120833269" ; affx:stopsAt "120833317" ; affx:commonToAll "1" . :Gene4969_e15 a affx:Exon ; affx:startsAt "120838181" ; affx:stopsAt "120838702" ; affx:commonToAll "1" . :Gene4970 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18381083] ; affx:hasVariant [affx:representedBy :gi18490725] . :gi18381083 a affx:Transcript ; affx:unigene "iMm.204698" ; affx:translatesTo "MWALGQAGFTNLTEGLKVWLGIMLPVLGIKALSPFAIAYLDRLLLMHPNLTKGFGMIGPKDFFPLLDFAYMPNNSLSPSLQEQLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMKKELLASLTQCLTVDPLSTSVWRQLYPKHLSQSSLLLEHLLKSWEHIPKKARKSLQETIQSLKVTNQELLKKGSGGSEHVLTCDTACKGLLQRARGPRPPWARLFLLLLVFAVGFLCHDLRSNSSLQASLTGRLLRSSGLLPVGQQVCARLSSYSLQSYNWLQETLPACGSHLLAVVQPSLQLAWTHIYAIFSFLSAHCASYLACFSDSLAGFFQRVQLPEALQQLFHALKELLLLFCHSVLLPTWHLLLAALAQVQEHCHEACRGDVTWDCIKTQLSRAAQWTWLCLQDVTVAFLDWALTMISQQ" ; affx:hasCds [affx:startsAt "29532764" ; affx:stopsAt "29537000" ]; affx:hasExon [ affx:relatesToExon :Gene4970_e2; affx:cdsType "Partial" ; affx:cdsStart "29532764" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e14; affx:cdsType "Partial" ; affx:cdsStop "29537000" ; affx:frame "0"] ; . :gi18490725 a affx:Transcript ; affx:unigene "iMm.204698" ; affx:translatesTo "MIGPKDFFPLLDFAYMPNNSLSPSLQEQLCQLFPRLKVLAFGAKPESSLHTYFPSFLSRATPSCPAAMKKELLASLTQCLTVDPLSTSVWRQLYPKHLSQSSLLLEHLLKSWEHIPKKARKSLQETIQSLKVTNQELLKKGSGGSEHVLTCDTACKGLLQRARGPRPPWARLFLLLLVFAVGFLCHDLRSNSSLQASLTGRLLRSSGLLPVGQQVCARLSSYSLQSYNWLQETLPACGSHLLAVVQPSLQLAWTHIYAIFSFLSAHCASYLACFSDSLAGFFQRVQLPEALQQLFHALKELLLLFCHSVLLPTWHLLLAALAQVQEHCHEACRGDVTWDCIKTQLSRAAQWTWLCLQDVTVAFLDWALTMISQQ" ; affx:hasCds [affx:startsAt "29533283" ; affx:stopsAt "29537000" ]; affx:hasExon [ affx:relatesToExon :Gene4970_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4970_e5; affx:cdsType "Partial" ; affx:cdsStart "29533283" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4970_e15; affx:cdsType "Partial" ; affx:cdsStop "29537000" ; affx:frame "1"] ; . :Gene4970_e1 a affx:Exon ; affx:startsAt "29529848" ; affx:stopsAt "29529941" ; affx:commonToAll "0" . :Gene4970_e2 a affx:Exon ; affx:startsAt "29532708" ; affx:stopsAt "29532816" ; affx:commonToAll "0" . :Gene4970_e3 a affx:Exon ; affx:startsAt "29532896" ; affx:stopsAt "29532978" ; affx:commonToAll "0" . :Gene4970_e4 a affx:Exon ; affx:startsAt "29533252" ; affx:stopsAt "29533354" ; affx:commonToAll "0" . :Gene4970_e5 a affx:Exon ; affx:startsAt "29533270" ; affx:stopsAt "29533354" ; affx:commonToAll "0" . :Gene4970_e6 a affx:Exon ; affx:startsAt "29533704" ; affx:stopsAt "29533846" ; affx:commonToAll "1" . :Gene4970_e7 a affx:Exon ; affx:startsAt "29534165" ; affx:stopsAt "29534257" ; affx:commonToAll "1" . :Gene4970_e8 a affx:Exon ; affx:startsAt "29534522" ; affx:stopsAt "29534571" ; affx:commonToAll "1" . :Gene4970_e9 a affx:Exon ; affx:startsAt "29534746" ; affx:stopsAt "29534860" ; affx:commonToAll "1" . :Gene4970_e10 a affx:Exon ; affx:startsAt "29535060" ; affx:stopsAt "29535178" ; affx:commonToAll "1" . :Gene4970_e11 a affx:Exon ; affx:startsAt "29535999" ; affx:stopsAt "29536096" ; affx:commonToAll "1" . :Gene4970_e12 a affx:Exon ; affx:startsAt "29536256" ; affx:stopsAt "29536425" ; affx:commonToAll "1" . :Gene4970_e13 a affx:Exon ; affx:startsAt "29536572" ; affx:stopsAt "29536718" ; affx:commonToAll "1" . :Gene4970_e14 a affx:Exon ; affx:startsAt "29536873" ; affx:stopsAt "29537671" ; affx:commonToAll "0" . :Gene4970_e15 a affx:Exon ; affx:startsAt "29536873" ; affx:stopsAt "29537673" ; affx:commonToAll "0" . :Gene4971 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18605715] . :gi18605715 a affx:Transcript ; affx:unigene "iMm.218582" ; affx:translatesTo "MSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPGLLIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPAESVIVANHSDSSGITPGEAAAIASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPGTHYA" ; affx:hasCds [affx:startsAt "121106208" ; affx:stopsAt "121120466" ]; affx:hasExon [ affx:relatesToExon :Gene4971_e1; affx:cdsType "Partial" ; affx:cdsStart "121106208" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4971_e2; affx:cdsType "Partial" ; affx:cdsStop "121120466" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "55" ; affx:stopsAt "77" ; affx:spannedBy [ affx:startsAt "121119911" ; affx:stopsAt "121119977" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "112" ; affx:stopsAt "134" ; affx:spannedBy [ affx:startsAt "121120082" ; affx:stopsAt "121120148" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "174" ; affx:stopsAt "196" ; affx:spannedBy [ affx:startsAt "121120268" ; affx:stopsAt "121120334" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4971_e1 a affx:Exon ; affx:startsAt "121106057" ; affx:stopsAt "121106322" ; affx:commonToAll "1" . :Gene4971_e2 a affx:Exon ; affx:startsAt "121119860" ; affx:stopsAt "121121236" ; affx:commonToAll "1" . :Gene4972 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18043570] . :gi18043570 a affx:Transcript ; affx:unigene "iMm.141383" ; affx:translatesTo "MPVTKCPRKVEPPWKGWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEGIWERGMKNGHGRFFHLDHGQLFEGYWVDNVAKCGTMIDFGRDEAPEPTQFPIPKVEILDPDGVLKEALDKLMKPEEEEG" ; affx:hasCds [affx:startsAt "121128198" ; affx:stopsAt "121137781" ]; affx:hasExon [ affx:relatesToExon :Gene4972_e1; affx:cdsType "Partial" ; affx:cdsStart "121128198" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4972_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4972_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4972_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4972_e5; affx:cdsType "Partial" ; affx:cdsStop "121137781" ; affx:frame "0"] ; . :Gene4972_e1 a affx:Exon ; affx:startsAt "121128042" ; affx:stopsAt "121128276" ; affx:commonToAll "1" . :Gene4972_e2 a affx:Exon ; affx:startsAt "121128591" ; affx:stopsAt "121128776" ; affx:commonToAll "1" . :Gene4972_e3 a affx:Exon ; affx:startsAt "121130172" ; affx:stopsAt "121130332" ; affx:commonToAll "1" . :Gene4972_e4 a affx:Exon ; affx:startsAt "121132088" ; affx:stopsAt "121132246" ; affx:commonToAll "1" . :Gene4972_e5 a affx:Exon ; affx:startsAt "121137636" ; affx:stopsAt "121137826" ; affx:commonToAll "1" . :Gene4973 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18204758] . :gi18204758 a affx:Transcript ; affx:unigene "iMm.11311" ; affx:translatesTo "MVVVSVPAEVTVILLDIEGTTTPIAFVKDVLFPYIKENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPVASGSDLQQMIQAVVDNVYWQMSHDRKTTALKQLQGHMWKAAFTAGRMKAEFFADVVPAVRRWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELIDGHFDTKIGHKVDSESYRKIADSIGCSTNNILFLTDVTVEASAAEEADVHVAVVVRPGNAGLTDDEKTYYNLITSFSELYLPST" ; affx:hasCds [affx:startsAt "97578927" ; affx:stopsAt "97605549" ]; affx:hasExon [ affx:relatesToExon :Gene4973_e1; affx:cdsType "Partial" ; affx:cdsStart "97578927" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4973_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4973_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4973_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4973_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4973_e6; affx:cdsType "Partial" ; affx:cdsStop "97605549" ; affx:frame "1"] ; . :Gene4973_e1 a affx:Exon ; affx:startsAt "97578785" ; affx:stopsAt "97579011" ; affx:commonToAll "1" . :Gene4973_e2 a affx:Exon ; affx:startsAt "97596754" ; affx:stopsAt "97596856" ; affx:commonToAll "1" . :Gene4973_e3 a affx:Exon ; affx:startsAt "97598587" ; affx:stopsAt "97598781" ; affx:commonToAll "1" . :Gene4973_e4 a affx:Exon ; affx:startsAt "97599756" ; affx:stopsAt "97599889" ; affx:commonToAll "1" . :Gene4973_e5 a affx:Exon ; affx:startsAt "97601372" ; affx:stopsAt "97601496" ; affx:commonToAll "1" . :Gene4973_e6 a affx:Exon ; affx:startsAt "97605412" ; affx:stopsAt "97606375" ; affx:commonToAll "1" . :Gene4974 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18044527] . :gi18044527 a affx:Transcript ; affx:unigene "iMm.31238" ; affx:translatesTo "MDFLVLFLFYLAFLLICVVLICIFTKSQRLKAVVLGGAQVCSRVIPQCLQRAVQTLLHQLFHTRHPTFIVLHLLLQGLVYAEYTCEVFGYCRELEFSLPYLLLPYVLLSVNLVFFTLTCAANPGTITKANESFLLQVYKFDDVMFPKNSRCPTCDLRKPARSKHCRLCDRCVHRFDHHCVWVNNCIGAWNTRYFLIYLLTLTASAATIATVTAAFLLRLVTVSDLYQETYLDDVGHFQAVDTVFLIQHLFLAFPRIVFLLGFVIVLSMLLAGYLCFALYLAATNQTTNEWYKGDWAWCQRWPLVAWSPSAEPRIHQNIHSHGFRSNLREIFLPATPSYKKKEK" ; affx:hasCds [affx:startsAt "142441637" ; affx:stopsAt "142451313" ]; affx:hasExon [ affx:relatesToExon :Gene4974_e1; affx:cdsType "Partial" ; affx:cdsStart "142441637" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4974_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4974_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4974_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4974_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4974_e6; affx:cdsType "Partial" ; affx:cdsStop "142451313" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4974_e7; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4974_e8; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "29" ; affx:spannedBy [ affx:startsAt "142451226" ; affx:stopsAt "142451313" ; affx:inFrame "2" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "4" ; affx:containsMotif [ affx:startsAt "68" ; affx:stopsAt "90" ; affx:spannedBy [ affx:startsAt "142449329" ; affx:stopsAt "142449395" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "100" ; affx:stopsAt "122" ; affx:spannedBy [ affx:startsAt "142449233" ; affx:stopsAt "142449299" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "194" ; affx:stopsAt "216" ; affx:spannedBy [ affx:startsAt "142445421" ; affx:stopsAt "142445487" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "256" ; affx:stopsAt "278" ; affx:spannedBy [ affx:startsAt "142441835" ; affx:stopsAt "142441901" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4974_e1 a affx:Exon ; affx:startsAt "142441584" ; affx:stopsAt "142441928" ; affx:commonToAll "1" . :Gene4974_e2 a affx:Exon ; affx:startsAt "142445328" ; affx:stopsAt "142445573" ; affx:commonToAll "1" . :Gene4974_e3 a affx:Exon ; affx:startsAt "142446866" ; affx:stopsAt "142446992" ; affx:commonToAll "1" . :Gene4974_e4 a affx:Exon ; affx:startsAt "142449229" ; affx:stopsAt "142449408" ; affx:commonToAll "1" . :Gene4974_e5 a affx:Exon ; affx:startsAt "142449982" ; affx:stopsAt "142450056" ; affx:commonToAll "1" . :Gene4974_e6 a affx:Exon ; affx:startsAt "142451196" ; affx:stopsAt "142451321" ; affx:commonToAll "1" . :Gene4974_e7 a affx:Exon ; affx:startsAt "142453488" ; affx:stopsAt "142453668" ; affx:commonToAll "1" . :Gene4974_e8 a affx:Exon ; affx:startsAt "142454263" ; affx:stopsAt "142454318" ; affx:commonToAll "1" . :Gene4975 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18204099] . :gi18204099 a affx:Transcript ; affx:unigene "iMm.218625" ; affx:translatesTo "MFGKLMTIAKNLPDPGKAQDFVKKFNQVLGDDEKLRSQLELLISPTCSCKQADVCVREIARKLANPKQPTNPFLEMVKFLLERIAPVHIDSEAISALVKLMNKSIEGTADDEEEGVSPDSAIRSGLELLKVLSFTHPTSFHSAETYESLLQCLRMEDDKVAEAAIQIFRNTGHKIETDLPQIRSTLIPILHQKAKRGTPHQAKQAVHCIHAIFSNKEVQLAQIFEPLSRSLNADVPEQLITPLVSLGHISMLAPDQFASPMKSVVANFIVKDLLMNDRSTGEKNGKLWSPDEEVSPEVLAKVQAIKLLVRWLLGMKNNQSKSANSTLRLLSAMLVSEGDLTEQKRISKSDMSRLRLAAGSAIMKLAQEPCYHEIITPEQFQLCALVINDECYQVRQIFAQKLHKALVKLLLPLEYMAIFALCAKDPVKERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKVISLT" ; affx:hasCds [affx:startsAt "64698688" ; affx:stopsAt "64722844" ]; affx:hasExon [ affx:relatesToExon :Gene4975_e1; affx:cdsType "Partial" ; affx:cdsStart "64698688" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e14; affx:cdsType "Partial" ; affx:cdsStop "64722844" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4975_e15; affx:cdsType "None" ] ; . :Gene4975_e1 a affx:Exon ; affx:startsAt "64698596" ; affx:stopsAt "64698826" ; affx:commonToAll "1" . :Gene4975_e2 a affx:Exon ; affx:startsAt "64699646" ; affx:stopsAt "64699779" ; affx:commonToAll "1" . :Gene4975_e3 a affx:Exon ; affx:startsAt "64702811" ; affx:stopsAt "64702926" ; affx:commonToAll "1" . :Gene4975_e4 a affx:Exon ; affx:startsAt "64703286" ; affx:stopsAt "64703491" ; affx:commonToAll "1" . :Gene4975_e5 a affx:Exon ; affx:startsAt "64703725" ; affx:stopsAt "64703849" ; affx:commonToAll "1" . :Gene4975_e6 a affx:Exon ; affx:startsAt "64705645" ; affx:stopsAt "64705782" ; affx:commonToAll "1" . :Gene4975_e7 a affx:Exon ; affx:startsAt "64707439" ; affx:stopsAt "64707508" ; affx:commonToAll "1" . :Gene4975_e8 a affx:Exon ; affx:startsAt "64709898" ; affx:stopsAt "64710057" ; affx:commonToAll "1" . :Gene4975_e9 a affx:Exon ; affx:startsAt "64711041" ; affx:stopsAt "64711165" ; affx:commonToAll "1" . :Gene4975_e10 a affx:Exon ; affx:startsAt "64713468" ; affx:stopsAt "64713629" ; affx:commonToAll "1" . :Gene4975_e11 a affx:Exon ; affx:startsAt "64714283" ; affx:stopsAt "64714389" ; affx:commonToAll "1" . :Gene4975_e12 a affx:Exon ; affx:startsAt "64719748" ; affx:stopsAt "64719864" ; affx:commonToAll "1" . :Gene4975_e13 a affx:Exon ; affx:startsAt "64722061" ; affx:stopsAt "64722201" ; affx:commonToAll "1" . :Gene4975_e14 a affx:Exon ; affx:startsAt "64722816" ; affx:stopsAt "64722865" ; affx:commonToAll "1" . :Gene4975_e15 a affx:Exon ; affx:startsAt "64723652" ; affx:stopsAt "64723734" ; affx:commonToAll "1" . :Gene4976 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18044001] . :gi18044001 a affx:Transcript ; affx:unigene "iMm.46582" ; affx:translatesTo "MALITIILQAFDKYHDGDFNIHSGYLYVTLVYNASVSLALYALFLFYFATRDLLRPFEPVLKFLTIKAIIFLSFWQGMLLAILERCGVIPEVQAVDGTRVGAGTLAAGYQNFLICVEMLFASLALRYAFPSQVYSEKKNSPVPPAPMQSISSGLKETISPQDIVQDAIHNFSPAYQQYTQQSTHEAPGPGQGGHPAPSTHPGPASGSGGGKKSRNIEKRMLIPSEDL" ; affx:hasCds [affx:startsAt "138697156" ; affx:stopsAt "138699353" ]; affx:hasExon [ affx:relatesToExon :Gene4976_e1; affx:cdsType "Partial" ; affx:cdsStart "138697156" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4976_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4976_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4976_e4; affx:cdsType "Partial" ; affx:cdsStop "138699353" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "3" ; affx:containsMotif [ affx:startsAt "26" ; affx:stopsAt "48" ; affx:spannedBy [ affx:startsAt "138698664" ; affx:stopsAt "138698730" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "60" ; affx:stopsAt "82" ; affx:spannedBy [ affx:startsAt "138698579" ; affx:stopsAt "138698628" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "138698034" ; affx:stopsAt "138698051" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "107" ; affx:stopsAt "129" ; affx:spannedBy [ affx:startsAt "138697893" ; affx:stopsAt "138697959" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4976_e1 a affx:Exon ; affx:startsAt "138696626" ; affx:stopsAt "138697416" ; affx:commonToAll "1" . :Gene4976_e2 a affx:Exon ; affx:startsAt "138697856" ; affx:stopsAt "138698051" ; affx:commonToAll "1" . :Gene4976_e3 a affx:Exon ; affx:startsAt "138698579" ; affx:stopsAt "138698749" ; affx:commonToAll "1" . :Gene4976_e4 a affx:Exon ; affx:startsAt "138699294" ; affx:stopsAt "138699387" ; affx:commonToAll "1" . :Gene4977 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18044116] . :gi18044116 a affx:Transcript ; affx:unigene "iMm.27662" ; affx:translatesTo "MPSRWPGVAGPPALARTEGGEGSAGHSYPQNSKGTGEQHKADRIKEGHRVYAHIAKLQELWKTTQIQTIHIPKSMTDASFLKHPELTLGQKRYLCSVAKICNSSYLRTLMKRQYMHIFHHGSQKTGVLTHHRGHMSSRYSQKQHSPCTAWRHHLEREDSLSIAAGAPEMIIHSLWRPLRHKEGLKIGYASKTRCKSLKIFRRPGRLFLLPVPSNDSQSCPSEETQEEDLLNKCMQSMSIQEQGPAHASLTV" ; affx:hasCds [affx:startsAt "120435176" ; affx:stopsAt "120442335" ]; affx:hasExon [ affx:relatesToExon :Gene4977_e1; affx:cdsType "Partial" ; affx:cdsStart "120435176" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4977_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4977_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4977_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4977_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4977_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4977_e7; affx:cdsType "Partial" ; affx:cdsStop "120442335" ; affx:frame "1"] ; . :Gene4977_e1 a affx:Exon ; affx:startsAt "120434961" ; affx:stopsAt "120435301" ; affx:commonToAll "1" . :Gene4977_e2 a affx:Exon ; affx:startsAt "120436695" ; affx:stopsAt "120436778" ; affx:commonToAll "1" . :Gene4977_e3 a affx:Exon ; affx:startsAt "120437729" ; affx:stopsAt "120437901" ; affx:commonToAll "1" . :Gene4977_e4 a affx:Exon ; affx:startsAt "120437980" ; affx:stopsAt "120438110" ; affx:commonToAll "1" . :Gene4977_e5 a affx:Exon ; affx:startsAt "120439897" ; affx:stopsAt "120440019" ; affx:commonToAll "1" . :Gene4977_e6 a affx:Exon ; affx:startsAt "120440895" ; affx:stopsAt "120440954" ; affx:commonToAll "1" . :Gene4977_e7 a affx:Exon ; affx:startsAt "120442270" ; affx:stopsAt "120442709" ; affx:commonToAll "1" . :Gene4978 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18043263] . :gi18043263 a affx:Transcript ; affx:unigene "iMm.28823" ; affx:translatesTo "MLQEESDLSLIIAQIVQKLKGSNLYAQLERQAWSCLQRPEIRLESLKEDIKEFFKISGWEKKLQNAVYSELNVFPLPSHPSAPPEHLKEPLVYMRKAQGSWEKRILKSLNSMCTELSIPLARKRPAMEQKELLNKWNEMGTDEPDLSLFRPVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKECFVELGLNTGQLGIDDSTQVPPELFENEHVRIGQKVLAQQDSAAAQQYIRQGSPTALRAELWALILNISSQPEDILYYEQLKTNVIQHDLLVDSLIYKDVKLTASNDDYYFVFEDYLYQVLLCFSRDTSVLGHFAYNSASPPKSYIRGKLGLEEYAVFYPPNGVIPFHGFSMYVAPLCFLYHEPYKLYQIFREMYVRFFFRLHSISSHPSGIVSLCLLFETLLQTYLPQLFYHLREIGAQPLRISFKWMVRAFSGYLATDQLLLLWDRILGYNSLEILAVLAAAVFAFRAVNLMEVTSLAAAEAVLADLSTLKVMPLLQIFLFATVT" ; affx:hasCds [affx:startsAt "52874336" ; affx:stopsAt "52967760" ]; affx:hasExon [ affx:relatesToExon :Gene4978_e1; affx:cdsType "Partial" ; affx:cdsStart "52874336" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e20; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4978_e21; affx:cdsType "Partial" ; affx:cdsStop "52967760" ; affx:frame "2"] ; . :Gene4978_e1 a affx:Exon ; affx:startsAt "52874244" ; affx:stopsAt "52874435" ; affx:commonToAll "1" . :Gene4978_e2 a affx:Exon ; affx:startsAt "52893927" ; affx:stopsAt "52894000" ; affx:commonToAll "1" . :Gene4978_e3 a affx:Exon ; affx:startsAt "52895032" ; affx:stopsAt "52895078" ; affx:commonToAll "1" . :Gene4978_e4 a affx:Exon ; affx:startsAt "52897547" ; affx:stopsAt "52897623" ; affx:commonToAll "1" . :Gene4978_e5 a affx:Exon ; affx:startsAt "52899749" ; affx:stopsAt "52899824" ; affx:commonToAll "1" . :Gene4978_e6 a affx:Exon ; affx:startsAt "52901173" ; affx:stopsAt "52901237" ; affx:commonToAll "1" . :Gene4978_e7 a affx:Exon ; affx:startsAt "52902501" ; affx:stopsAt "52902548" ; affx:commonToAll "1" . :Gene4978_e8 a affx:Exon ; affx:startsAt "52902704" ; affx:stopsAt "52902815" ; affx:commonToAll "1" . :Gene4978_e9 a affx:Exon ; affx:startsAt "52909254" ; affx:stopsAt "52909327" ; affx:commonToAll "1" . :Gene4978_e10 a affx:Exon ; affx:startsAt "52913146" ; affx:stopsAt "52913185" ; affx:commonToAll "1" . :Gene4978_e11 a affx:Exon ; affx:startsAt "52914822" ; affx:stopsAt "52914935" ; affx:commonToAll "1" . :Gene4978_e12 a affx:Exon ; affx:startsAt "52921832" ; affx:stopsAt "52921907" ; affx:commonToAll "1" . :Gene4978_e13 a affx:Exon ; affx:startsAt "52924320" ; affx:stopsAt "52924383" ; affx:commonToAll "1" . :Gene4978_e14 a affx:Exon ; affx:startsAt "52936700" ; affx:stopsAt "52936785" ; affx:commonToAll "1" . :Gene4978_e15 a affx:Exon ; affx:startsAt "52939334" ; affx:stopsAt "52939379" ; affx:commonToAll "1" . :Gene4978_e16 a affx:Exon ; affx:startsAt "52948211" ; affx:stopsAt "52948244" ; affx:commonToAll "1" . :Gene4978_e17 a affx:Exon ; affx:startsAt "52951903" ; affx:stopsAt "52952013" ; affx:commonToAll "1" . :Gene4978_e18 a affx:Exon ; affx:startsAt "52953865" ; affx:stopsAt "52953957" ; affx:commonToAll "1" . :Gene4978_e19 a affx:Exon ; affx:startsAt "52961344" ; affx:stopsAt "52961460" ; affx:commonToAll "1" . :Gene4978_e20 a affx:Exon ; affx:startsAt "52965930" ; affx:stopsAt "52966001" ; affx:commonToAll "1" . :Gene4978_e21 a affx:Exon ; affx:startsAt "52967685" ; affx:stopsAt "52967889" ; affx:commonToAll "1" . :Gene4979 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18043414] . :gi18043414 a affx:Transcript ; affx:unigene "iMm.46533" ; affx:translatesTo "MSQSKHAEARELMYSGALLFFSHGQQNSAADLSMLVLESLEKAEVDVADELLENLAKVFSLMDPNSPERVAFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSSDGEGCANMLVEYSTARGFRSEVDMFVAQAVLQFLCLKNKNSALVVFTTYTQKHPSIEDGPPFVQPLLNFIWFLLLAVDGGKLAVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLSSLMGSSEQEEGEESQDDSSPIELD" ; affx:hasCds [affx:startsAt "138151524" ; affx:stopsAt "138158109" ]; affx:hasExon [ affx:relatesToExon :Gene4979_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4979_e2; affx:cdsType "Partial" ; affx:cdsStart "138151524" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4979_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4979_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4979_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4979_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4979_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4979_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4979_e9; affx:cdsType "Partial" ; affx:cdsStop "138158109" ; affx:frame "0"] ; . :Gene4979_e1 a affx:Exon ; affx:startsAt "138142554" ; affx:stopsAt "138142641" ; affx:commonToAll "1" . :Gene4979_e2 a affx:Exon ; affx:startsAt "138151520" ; affx:stopsAt "138151599" ; affx:commonToAll "1" . :Gene4979_e3 a affx:Exon ; affx:startsAt "138151909" ; affx:stopsAt "138151991" ; affx:commonToAll "1" . :Gene4979_e4 a affx:Exon ; affx:startsAt "138152518" ; affx:stopsAt "138152668" ; affx:commonToAll "1" . :Gene4979_e5 a affx:Exon ; affx:startsAt "138154666" ; affx:stopsAt "138154805" ; affx:commonToAll "1" . :Gene4979_e6 a affx:Exon ; affx:startsAt "138156043" ; affx:stopsAt "138156184" ; affx:commonToAll "1" . :Gene4979_e7 a affx:Exon ; affx:startsAt "138156266" ; affx:stopsAt "138156342" ; affx:commonToAll "1" . :Gene4979_e8 a affx:Exon ; affx:startsAt "138156442" ; affx:stopsAt "138156515" ; affx:commonToAll "1" . :Gene4979_e9 a affx:Exon ; affx:startsAt "138158020" ; affx:stopsAt "138158369" ; affx:commonToAll "1" . :Gene4980 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18044147] . :gi18044147 a affx:Transcript ; affx:unigene "iMm.41029" ; affx:translatesTo "MAWTKYQLFLAGLMLVTGSINTLSAKWADNFVAEGCGGSQEHSFKHPFVQAVGMFLGEFSCLAAFYLLKCQGRRQSASSVEPQQPFNTLLFLPPALCDMTGTSIMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLDRRLAPSQWLGILITIAGLVVVGLADLLSKHDSQHKLSEVITGDLLIIMAQIIIAIQMVLEEKFVYKHNIHPLQAVGIEGFFGFVILSLLLVPMFYIPTASFSGNPRGVLEDALDAFCQVGRQPLIALALLGNISSIAFFNFSGISVTKELSATTRMVLDTLRTIVIWAFTLALGWEIFYPLQILGFLILLMGTALYNGLHRPLLAFLSRRWRLPTQEGEQERLLGDSRTPINEAS" ; affx:hasCds [affx:startsAt "29307412" ; affx:stopsAt "29317240" ]; affx:hasExon [ affx:relatesToExon :Gene4980_e1; affx:cdsType "Partial" ; affx:cdsStart "29307412" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4980_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4980_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4980_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4980_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4980_e6; affx:cdsType "Partial" ; affx:cdsStop "29317240" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "25" ; affx:spannedBy [ affx:startsAt "29307412" ; affx:stopsAt "29307487" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "46" ; affx:stopsAt "68" ; affx:spannedBy [ affx:startsAt "29314199" ; affx:stopsAt "29314211" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "29314885" ; affx:stopsAt "29314939" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "89" ; affx:stopsAt "109" ; affx:spannedBy [ affx:startsAt "29315002" ; affx:stopsAt "29315057" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "29315278" ; affx:stopsAt "29315283" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "119" ; affx:stopsAt "136" ; affx:spannedBy [ affx:startsAt "29315313" ; affx:stopsAt "29315364" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "145" ; affx:stopsAt "164" ; affx:spannedBy [ affx:startsAt "29315391" ; affx:stopsAt "29315448" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "174" ; affx:stopsAt "196" ; affx:spannedBy [ affx:startsAt "29315478" ; affx:stopsAt "29315491" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "29316137" ; affx:stopsAt "29316190" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "259" ; affx:stopsAt "281" ; affx:spannedBy [ affx:startsAt "29316898" ; affx:stopsAt "29316964" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "301" ; affx:stopsAt "323" ; affx:spannedBy [ affx:startsAt "29317024" ; affx:stopsAt "29317090" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4980_e1 a affx:Exon ; affx:startsAt "29307344" ; affx:stopsAt "29307489" ; affx:commonToAll "1" . :Gene4980_e2 a affx:Exon ; affx:startsAt "29314138" ; affx:stopsAt "29314211" ; affx:commonToAll "1" . :Gene4980_e3 a affx:Exon ; affx:startsAt "29314885" ; affx:stopsAt "29315057" ; affx:commonToAll "1" . :Gene4980_e4 a affx:Exon ; affx:startsAt "29315278" ; affx:stopsAt "29315491" ; affx:commonToAll "1" . :Gene4980_e5 a affx:Exon ; affx:startsAt "29316137" ; affx:stopsAt "29316248" ; affx:commonToAll "1" . :Gene4980_e6 a affx:Exon ; affx:startsAt "29316767" ; affx:stopsAt "29317510" ; affx:commonToAll "1" . :Gene4981 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18204701] . :gi18204701 a affx:Transcript ; affx:unigene "iMm.9654" ; affx:translatesTo "MKALHLQHRSPTSYRVKARASYVDETLFGSPARTRPAQPDFDPPWVQNCNRSRGVGPGPPKGSLAKRDCESPSSRGSTPNLTPRKKNKYRLIGHAPSYCDESLFGTSKEGSRMAVGDAAKLRTLFWTPPATPRGSHTPCPRETPLRAIHPAGPSRTEPRVTAGSQMSSQDGLCVPCSLGQRRSHSLTHLTVPSTGHPASSAPQTNGPWSPRPNTSGATVQSPLVTSKACSGRVSGPAPPRRGACPPKPKPPWK" ; affx:hasCds [affx:startsAt "118665738" ; affx:stopsAt "118667915" ]; affx:hasExon [ affx:relatesToExon :Gene4981_e1; affx:cdsType "Partial" ; affx:cdsStart "118665738" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4981_e2; affx:cdsType "Partial" ; affx:cdsStop "118667915" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4981_e3; affx:cdsType "None" ] ; . :Gene4981_e1 a affx:Exon ; affx:startsAt "118665326" ; affx:stopsAt "118666231" ; affx:commonToAll "1" . :Gene4981_e2 a affx:Exon ; affx:startsAt "118667646" ; affx:stopsAt "118667998" ; affx:commonToAll "1" . :Gene4981_e3 a affx:Exon ; affx:startsAt "118668542" ; affx:stopsAt "118668744" ; affx:commonToAll "1" . :Gene4982 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18203930] . :gi18203930 a affx:Transcript ; affx:unigene "iMm.18959" ; affx:translatesTo "MAVDITLLFRASVKTVKTRNKALGVAVGGGADGSRDELFRRSPRPKGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQIDQDAQIFIRTCSEAIHQLRTEGVCKLYSEQRAIRVKRVVDKKRLSKLEPEPHTKRKDSTSEKAPQNASQDSEGKPAAEELPEKPLAESQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEISRLQEIFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS" ; affx:hasCds [affx:startsAt "36940133" ; affx:stopsAt "37037236" ]; affx:hasExon [ affx:relatesToExon :Gene4982_e1; affx:cdsType "Partial" ; affx:cdsStart "36940133" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4982_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4982_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4982_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4982_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4982_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4982_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4982_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4982_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4982_e10; affx:cdsType "Partial" ; affx:cdsStop "37037236" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "284" ; affx:stopsAt "306" ; affx:spannedBy [ affx:startsAt "37037161" ; affx:stopsAt "37037227" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4982_e1 a affx:Exon ; affx:startsAt "36940052" ; affx:stopsAt "36940301" ; affx:commonToAll "1" . :Gene4982_e2 a affx:Exon ; affx:startsAt "36993159" ; affx:stopsAt "36993227" ; affx:commonToAll "1" . :Gene4982_e3 a affx:Exon ; affx:startsAt "37005533" ; affx:stopsAt "37005649" ; affx:commonToAll "1" . :Gene4982_e4 a affx:Exon ; affx:startsAt "37007481" ; affx:stopsAt "37007548" ; affx:commonToAll "1" . :Gene4982_e5 a affx:Exon ; affx:startsAt "37016740" ; affx:stopsAt "37016853" ; affx:commonToAll "1" . :Gene4982_e6 a affx:Exon ; affx:startsAt "37021866" ; affx:stopsAt "37021955" ; affx:commonToAll "1" . :Gene4982_e7 a affx:Exon ; affx:startsAt "37027587" ; affx:stopsAt "37027646" ; affx:commonToAll "1" . :Gene4982_e8 a affx:Exon ; affx:startsAt "37028699" ; affx:stopsAt "37028769" ; affx:commonToAll "1" . :Gene4982_e9 a affx:Exon ; affx:startsAt "37036099" ; affx:stopsAt "37036180" ; affx:commonToAll "1" . :Gene4982_e10 a affx:Exon ; affx:startsAt "37037140" ; affx:stopsAt "37037697" ; affx:commonToAll "1" . :Gene4983 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi1732346] . :gi1732346 a affx:Transcript ; affx:unigene "iMm.5196" ; affx:translatesTo "MEYDAYNDSGIYDDEYSDGFGYFVDLEEASPWEAKVAPVFLVVIYSLVCFLGLLGNGLVIVIATFKMKKTVNTVWFVNLAVADFLFNIFLPMHITYAAMDYHWVFGKAMCKISNFLLSHNMYTSVFLLTVISFDRCISVLLPVWSQNHRSIRLAYMTCSAVWVLAFFLSSPSLVFRDTANIHGKITCFNNFSLAAPESSPHPAHSQVVSTGYSRHVAVTVTRFLCGFLIPVFIITACYLTIVFKLQRNRLAKNKKPFKIIITIIITFFLCWCPYHTLYLLELHHTAVPSSVFSLGLPLATAVAIANSCMNPILYVFMGHDFRKFKVALFSRLANALSEDTGPSSYPSHRSFTKMSSLNEKASVNEKETSTL" ; affx:hasCds [affx:startsAt "111517280" ; affx:stopsAt "111518396" ]; affx:hasExon [ affx:relatesToExon :Gene4983_e1; affx:cdsType "Partial" ; affx:cdsStart "111517280" ; affx:cdsStop "111518396" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4983_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4983_e3; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "39" ; affx:stopsAt "61" ; affx:spannedBy [ affx:startsAt "111518213" ; affx:stopsAt "111518279" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "74" ; affx:stopsAt "96" ; affx:spannedBy [ affx:startsAt "111518108" ; affx:stopsAt "111518174" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "122" ; affx:stopsAt "144" ; affx:spannedBy [ affx:startsAt "111517964" ; affx:stopsAt "111518030" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "151" ; affx:stopsAt "173" ; affx:spannedBy [ affx:startsAt "111517877" ; affx:stopsAt "111517943" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "223" ; affx:stopsAt "245" ; affx:spannedBy [ affx:startsAt "111517661" ; affx:stopsAt "111517727" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "257" ; affx:stopsAt "279" ; affx:spannedBy [ affx:startsAt "111517559" ; affx:stopsAt "111517625" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "294" ; affx:stopsAt "316" ; affx:spannedBy [ affx:startsAt "111517448" ; affx:stopsAt "111517514" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene4983_e1 a affx:Exon ; affx:startsAt "111516791" ; affx:stopsAt "111518398" ; affx:commonToAll "1" . :Gene4983_e2 a affx:Exon ; affx:startsAt "111519985" ; affx:stopsAt "111520074" ; affx:commonToAll "1" . :Gene4983_e3 a affx:Exon ; affx:startsAt "111553283" ; affx:stopsAt "111553451" ; affx:commonToAll "1" . :Gene4984 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi471977] . :gi471977 a affx:Transcript ; affx:unigene "iMm.4572" ; affx:translatesTo "MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR" ; affx:hasCds [affx:startsAt "31126752" ; affx:stopsAt "31158460" ]; affx:hasExon [ affx:relatesToExon :Gene4984_e1; affx:cdsType "Partial" ; affx:cdsStart "31126752" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4984_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4984_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4984_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4984_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4984_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4984_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4984_e8; affx:cdsType "Partial" ; affx:cdsStop "31158460" ; affx:frame "1"] ; . :Gene4984_e1 a affx:Exon ; affx:startsAt "31126658" ; affx:stopsAt "31126804" ; affx:commonToAll "1" . :Gene4984_e2 a affx:Exon ; affx:startsAt "31145466" ; affx:stopsAt "31145598" ; affx:commonToAll "1" . :Gene4984_e3 a affx:Exon ; affx:startsAt "31148090" ; affx:stopsAt "31148321" ; affx:commonToAll "1" . :Gene4984_e4 a affx:Exon ; affx:startsAt "31150761" ; affx:stopsAt "31150866" ; affx:commonToAll "1" . :Gene4984_e5 a affx:Exon ; affx:startsAt "31152660" ; affx:stopsAt "31152732" ; affx:commonToAll "1" . :Gene4984_e6 a affx:Exon ; affx:startsAt "31153282" ; affx:stopsAt "31153434" ; affx:commonToAll "1" . :Gene4984_e7 a affx:Exon ; affx:startsAt "31154972" ; affx:stopsAt "31155107" ; affx:commonToAll "1" . :Gene4984_e8 a affx:Exon ; affx:startsAt "31158355" ; affx:stopsAt "31159624" ; affx:commonToAll "1" . :Gene4985 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi885885] . :gi885885 a affx:Transcript ; affx:unigene "iMm.23793" ; affx:translatesTo "MKTNIINTWHSFVNIPNVIVPAIEKEIRRMENGACSSFSDDDNGSLSEESENEDSFFRSNSYKRRGPSQREQHLPGTMALFNVNNSSNKDQEPKEKKKKKKEKKSKADDKNENKKDPEKKKKKEKEKEKKKKEEKTKEKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYIKFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYPDVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIANMGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIETEFSALEEPGGESELTESLQD" ; affx:hasCds [affx:startsAt "71714915" ; affx:stopsAt "71729919" ]; affx:hasExon [ affx:relatesToExon :Gene4985_e1; affx:cdsType "Partial" ; affx:cdsStart "71714915" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4985_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4985_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4985_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4985_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4985_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4985_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4985_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "292" ; affx:stopsAt "314" ; affx:spannedBy [ affx:startsAt "71716028" ; affx:stopsAt "71716094" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "367" ; affx:stopsAt "389" ; affx:spannedBy [ affx:startsAt "71715803" ; affx:stopsAt "71715869" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4985_e1 a affx:Exon ; affx:startsAt "71714674" ; affx:stopsAt "71716330" ; affx:commonToAll "1" . :Gene4985_e2 a affx:Exon ; affx:startsAt "71720255" ; affx:stopsAt "71720362" ; affx:commonToAll "1" . :Gene4985_e3 a affx:Exon ; affx:startsAt "71721609" ; affx:stopsAt "71721717" ; affx:commonToAll "1" . :Gene4985_e4 a affx:Exon ; affx:startsAt "71722961" ; affx:stopsAt "71723072" ; affx:commonToAll "1" . :Gene4985_e5 a affx:Exon ; affx:startsAt "71723161" ; affx:stopsAt "71723203" ; affx:commonToAll "1" . :Gene4985_e6 a affx:Exon ; affx:startsAt "71727522" ; affx:stopsAt "71727585" ; affx:commonToAll "1" . :Gene4985_e7 a affx:Exon ; affx:startsAt "71728968" ; affx:stopsAt "71729070" ; affx:commonToAll "1" . :Gene4985_e8 a affx:Exon ; affx:startsAt "71729812" ; affx:stopsAt "71729919" ; affx:commonToAll "1" . :Gene4986 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi849052] . :gi849052 a affx:Transcript ; affx:unigene "iMm.6584" ; affx:translatesTo "MTTYNNKGPKPERGRFLHFHSVTFWVGNAKQAASFYCNKMGFEPLAYRGLETGSREVVSHVIKQGKIVFVLCSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDHIVQKARERGAKIVREPWVEQDKFGKVKFAVLQTYGDTTHTLVEKINYTGRFLPGFEAPTYKDTLLPKLPRCNLEIIDHIVGNQPDQEMQSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVTNYEESIKMPINEPAPGRKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGTEFLAAPSSYYKLLRENLKSAKIQVKESMDVLEELHILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQALRGNLTDLEPNGVRSGM" ; affx:hasCds [affx:startsAt "121266178" ; affx:stopsAt "121276876" ]; affx:hasExon [ affx:relatesToExon :Gene4986_e1; affx:cdsType "Partial" ; affx:cdsStart "121266178" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4986_e14; affx:cdsType "Partial" ; affx:cdsStop "121276876" ; affx:frame "2"] ; . :Gene4986_e1 a affx:Exon ; affx:startsAt "121266010" ; affx:stopsAt "121266289" ; affx:commonToAll "1" . :Gene4986_e2 a affx:Exon ; affx:startsAt "121266370" ; affx:stopsAt "121266487" ; affx:commonToAll "1" . :Gene4986_e3 a affx:Exon ; affx:startsAt "121268550" ; affx:stopsAt "121268673" ; affx:commonToAll "1" . :Gene4986_e4 a affx:Exon ; affx:startsAt "121270090" ; affx:stopsAt "121270162" ; affx:commonToAll "1" . :Gene4986_e5 a affx:Exon ; affx:startsAt "121270291" ; affx:stopsAt "121270454" ; affx:commonToAll "1" . :Gene4986_e6 a affx:Exon ; affx:startsAt "121271728" ; affx:stopsAt "121271806" ; affx:commonToAll "1" . :Gene4986_e7 a affx:Exon ; affx:startsAt "121272368" ; affx:stopsAt "121272472" ; affx:commonToAll "1" . :Gene4986_e8 a affx:Exon ; affx:startsAt "121273565" ; affx:stopsAt "121273655" ; affx:commonToAll "1" . :Gene4986_e9 a affx:Exon ; affx:startsAt "121274846" ; affx:stopsAt "121274929" ; affx:commonToAll "1" . :Gene4986_e10 a affx:Exon ; affx:startsAt "121275086" ; affx:stopsAt "121275129" ; affx:commonToAll "1" . :Gene4986_e11 a affx:Exon ; affx:startsAt "121275622" ; affx:stopsAt "121275727" ; affx:commonToAll "1" . :Gene4986_e12 a affx:Exon ; affx:startsAt "121276060" ; affx:stopsAt "121276123" ; affx:commonToAll "1" . :Gene4986_e13 a affx:Exon ; affx:startsAt "121276745" ; affx:stopsAt "121276772" ; affx:commonToAll "1" . :Gene4986_e14 a affx:Exon ; affx:startsAt "121276873" ; affx:stopsAt "121276924" ; affx:commonToAll "1" . :Hdh a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi454416] ; affx:hasVariant [affx:representedBy :gi902003] . :gi454416 a affx:Transcript ; affx:unigene "iMm.16554" ; affx:translatesTo "MATLEKLMKAFESLKSFQQQQQQQPPPQPPPPPPPPPPQPPQPPPQGQPPPPPPPLPGPAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTVRRTAAGSAVSICQHSRRTQYFYNWLLNVLLGLLVPMEEEHSTLLILGVLLTLRCLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSTEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQALTTPGGLGQLTLVQEEARGRGRSGSIVELLAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSAFAASVKSEIGGELAASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGCDLTSAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGADSQYLGMQIGQPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLERMGHSRQPSDSSIDKYVTRDEVAEASDPESKPCRIKGDIGQPNDDDSAPLVHCVRLLSASFLLTGEKKALVPDRDVRVSVKALALSCIGAAVALHPESFFSRLYKVPLNTTESTEEQYVSDILNYIDHGDPQVRGATAILCGTLVYSILSRSRLRVGDWLGNIRTLTGNTFSLVDCIPLLQKTLKDESSVTCKLACTAVRHCVLSLCSSSYSDLGLQLLIDMLPLKNSSYWLVRTELLDTLAEIDFRLVSFLEAKAESLHRGAHHYTGFLKLQERVLNNVVIYLLGDEDPRVRHVAATSLTRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYSLLPSITDVTMENNLSRVVAAVSHELITSTTRALTFGCCEALCLLSAAFPVCTWSLGWHCGVPPLSASDESRKSCTVGMASMILTLLSSAWFPLDLSAHQDALILAGTLLAASAPKSLRSSWTSEEEANSAATRQEEIWPALGDRTLVPLVEQLFSHLLKVINICAHVLDDVTPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASTPMSPKKVGEASAASRQSDTSGPVTASKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEVLGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQCRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSAQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQVADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFITPSTMASVSTVQLWISGILAILRVLISQSTEDIVLCRIQELSFSPHLLSCPVINRLRGGGGNVTLGECSEGKQKSLPEDTFSRFLLQLVGILLEDIVTKQLKVDMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFTSDGCEGSFYTLESLNARVRSMVPTHPALVLLWCQILLLINHTDHRWWAEVQQTPKRHSLSCTKSLNPQKSGEEEDSGSAAQLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAIHRNSAASGLFIQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLTLYVDRLLGTPFRALARMVDTLACRRVEMLLAANLQSSMAQLPEEELNRIQEHLQNSGLAQRHQRLYSLLDRFRLSTVQDSLSPLPPVTSHPLDGDGHTSLETVSPDKDWYLQLVRSQCWTRSDSALLEGAELVNRIPAEDMNDFMMSSEFNLSLLAPCLSLGMSEIANGQKSPLFEAARGVILNRVTSVVQQLPAVHQVFQPFLPIEPTAYWNKLNDLLGDTTSYQSLTILARALAQYLVVLSKVPAHLHLPPEKEGDTVKFVVMTVEALSWHLIHEQIPLSLDLQAGLDCCCLALQVPGLWGVLSSPEYVTHACSLIHCVRFILEAIAVQPGDQLLGPESRSHTPRAVRKEEVDSDIQNLSHVTSACEMVADMVESLQSVLALGHKRNSTLPSFLTAVLKNIVISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTVFPEIPVEFLQEKEILKEFIYRINTLGWTNRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQIHVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSMIRGIVEQEIQEMVSQRENTATHHSHQAWDPVPSLLPATTGALISHDKLLLQINPEREPGNMSYKLGQVSIHSVWLGNNITPLREEEWDEEEEEESDVPAPTSPPVSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSAARRTPVILISEVVRSLLVVSDLFTERTQFEMMYLTLTELRRVHPSEDEILIQYLVPATCKAAAVLGMDKTVAEPVSRLLESTLRSSHLPSQIGALHGILYVLECDLLDDTAKQLIPVVSDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLMENYPLDVGPEFSASVIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDTESLVKLSVDRVNVQSPHRAMAALGLMLTCMYTGKEKASPGRASDPSPATPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSAGQSSMVRDWVMLSLSNFTQRTPVAMAMWSLSCFLVSASTSPWVSAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEEFDRRAFQSVFEVVAAPGSPYHRLLACLQNVHKVTTC" ; affx:hasCds [affx:startsAt "33468897" ; affx:stopsAt "33616047" ]; affx:hasExon [ affx:relatesToExon :Hdh_e2; affx:cdsType "Partial" ; affx:cdsStart "33468897" ; affx:cdsStop "33468981" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e18; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e21; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e22; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e24; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e25; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e26; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e27; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e28; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e29; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e30; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e31; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e32; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e33; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e34; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e35; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e36; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e37; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e38; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e39; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e40; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e41; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e42; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e43; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e44; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e45; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e46; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e47; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e48; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e49; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e50; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e51; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e52; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e53; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e54; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e55; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e56; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e57; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e58; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e59; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e60; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e61; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e62; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e63; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e64; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e65; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e66; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e67; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e69; affx:cdsType "Partial" ; affx:cdsStop "33616047" ; affx:frame "2"] ; . :gi902003 a affx:Transcript ; affx:unigene "iMm.16554" ; affx:translatesTo "MATLEKLMKAFESLKSFQQQQQQQPPPQAPPPPPPPPPQPPQPPPQGQPPPPPPPLPGPAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSLRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTVRRTAAGSAVSICQHSRRTQYFYNWLLNVLLGLLVPMEEEHSTLLILGVLLTLRCLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSTEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQALTTPGGLGQLTLVQEEARGRGRSGSIVELLAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSAFAASVKSEIGGELAASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGCDLTSAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGADSQYLGMQIGQPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLERMGHSRQPSDSSIDKYVTRDEVAEASDPESKPCRIKGDIGQPNDDDSAPLVHCVRLLSASFLLTGEKKALVPDRDVRVSVKALALSCIGAAVALHPESFFSRLYKVPLNTTESTEEQYVSDILNYIDHGDPQVRGATAILCGTLVYSILSRSRLRVGDWLGNIRTLTGNTFSLVDCIPLLQKTLKDESSVTCKLACTAVRHCVLSLCSSSYSDLGLQLLIDMLPLKNSSYWLVRTELLDTLAEIDFRLVSFLEAKAESLHRGAHHYTGFLKLQERVLNNVVIYLLGDEDPRVRHVAATSLTRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYSLLPSITDVTMENNLSRVVAAVSHELITSTTRALTFGCCEALCLLSAAFPVCTWSLGWHCGVPPLSASDESRKSCTVGMASMILTLLSSAWFPLDLSAHQDALILAGTLLAASAPKSLRSSWTSEEEANSAATRQEEIWPALGDRTLVPLVEQLFSHLLKVINICAHVLDDVTPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASTPMSPKKVGEASAASRQSDTSGPVTASKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEVLGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQCRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSAQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQVADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFITPSTMASVSTVQLWISGILAILRVLISQSTEDIVLCRIQELSFSPHLLSCPVINRLRGGGGNVTLGECSEGKQKSLPEDTFSRFLLQLVGILLEDIVTKQLKVDMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFTSDGCEGSFYTLESLNARVRSMVPTHPALVLLWCQILLLINHTDHRWWAEVQQTPKRHSLSCTKSLNPQKSGEEEDSGSAAQLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAIHRNSAASGLFIQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLTLYVDRLLGTPFRALARMVDTLACRRVEMLLAANLQSSMAQLPEEELNRIQEHLQNSGLAQRHQRLYSLLDRFRLSTVQDSLSPLPPVTSHPLDGDGHTSLETVSPDKDWYLQLVRSQCWTRSDSALLEGAELVNRIPAEDMNDFMMSSEFNLSLLAPCLSLGMSEIANGQKSPLFEAARGVILNRVTSVVQQLPAVHQVFQPFLPIEPTAYWNKLNDLLGDTTSYQSLTILARALAQYLVVLSKVPAHLHLPPEKEGDTVKFVVMTVEALSWHLIHEQIPLSLDLQAGLDCCCLALQVPGLWGVLSSPEYVTHACSLIHCVRFILEAIAVQPGDQLLGPESRSHTPRAVRKEEVDSDIQNLSHVTSACEMVADMVESLQSVLALGHKRNSTLPSFLTAVLKNIVISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTVFPEIPVEFLQEKEILKEFIYRINTLGWTNRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQIHVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSMIRGIVEQEIQEMVSQRENTATHHSHQAWDPVPSLLPATTGALISHDKLLLQINPEREPGNMSYKLGQVSIHSVWLGNNITPLREEEWDEEEEEESDVPAPTSPPVSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSAARRTPVILISEVVRSLLVVSDLFTERTQFEMMYLTLTELRRVHPSEDEILIQYLVPATCKAAAVLGMDKTVAEPVSRLLESTLRSSHLPSQIGALHGILYVLECDLLDDTAKQLIPVVSDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLMENYPLDVGPEFSASVIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDTESLVKLSVDRVNVQSPHRAMAALGLMLTCMYTGKEKASPGRASDPSPATPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSAGQSSMVRDWVMLSLSNFTQRTPVAMAMWSLSCFLVSASTSPWVSAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEEFDRRAFQSVFEVVAAPGSPYHRLLACLQNVHKVTTC" ; affx:hasCds [affx:startsAt "33468897" ; affx:stopsAt "33616047" ]; affx:hasExon [ affx:relatesToExon :Hdh_e1; affx:cdsType "Partial" ; affx:cdsStart "33468897" ; affx:cdsStop "33469004" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e18; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e21; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e22; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e24; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e25; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e26; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e27; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e28; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e29; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e30; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e31; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e32; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e33; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e34; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e35; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e36; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e37; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e38; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e39; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e40; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e41; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e42; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e43; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e44; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e45; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e46; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e47; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e48; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e49; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e50; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e51; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e52; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e53; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e54; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e55; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e56; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e57; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e58; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Hdh_e59; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e60; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e61; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e62; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hdh_e63; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e64; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e65; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e66; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e67; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hdh_e68; affx:cdsType "Partial" ; affx:cdsStop "33616047" ; affx:frame "2"] ; . :Hdh_e1 a affx:Exon ; affx:startsAt "33468767" ; affx:stopsAt "33469100" ; affx:commonToAll "0" . :Hdh_e2 a affx:Exon ; affx:startsAt "33468808" ; affx:stopsAt "33469100" ; affx:commonToAll "0" . :Hdh_e3 a affx:Exon ; affx:startsAt "33489730" ; affx:stopsAt "33489814" ; affx:commonToAll "1" . :Hdh_e4 a affx:Exon ; affx:startsAt "33497402" ; affx:stopsAt "33497523" ; affx:commonToAll "1" . :Hdh_e5 a affx:Exon ; affx:startsAt "33501240" ; affx:stopsAt "33501300" ; affx:commonToAll "1" . :Hdh_e6 a affx:Exon ; affx:startsAt "33503026" ; affx:stopsAt "33503106" ; affx:commonToAll "1" . :Hdh_e7 a affx:Exon ; affx:startsAt "33506511" ; affx:stopsAt "33506650" ; affx:commonToAll "1" . :Hdh_e8 a affx:Exon ; affx:startsAt "33510813" ; affx:stopsAt "33510955" ; affx:commonToAll "1" . :Hdh_e9 a affx:Exon ; affx:startsAt "33511597" ; affx:stopsAt "33511776" ; affx:commonToAll "1" . :Hdh_e10 a affx:Exon ; affx:startsAt "33513668" ; affx:stopsAt "33513873" ; affx:commonToAll "1" . :Hdh_e11 a affx:Exon ; affx:startsAt "33514964" ; affx:stopsAt "33515012" ; affx:commonToAll "1" . :Hdh_e12 a affx:Exon ; affx:startsAt "33518530" ; affx:stopsAt "33518611" ; affx:commonToAll "1" . :Hdh_e13 a affx:Exon ; affx:startsAt "33519947" ; affx:stopsAt "33520288" ; affx:commonToAll "1" . :Hdh_e14 a affx:Exon ; affx:startsAt "33524238" ; affx:stopsAt "33524365" ; affx:commonToAll "1" . :Hdh_e15 a affx:Exon ; affx:startsAt "33524793" ; affx:stopsAt "33524912" ; affx:commonToAll "1" . :Hdh_e16 a affx:Exon ; affx:startsAt "33525694" ; affx:stopsAt "33525806" ; affx:commonToAll "1" . :Hdh_e17 a affx:Exon ; affx:startsAt "33525992" ; affx:stopsAt "33526130" ; affx:commonToAll "1" . :Hdh_e18 a affx:Exon ; affx:startsAt "33527046" ; affx:stopsAt "33527205" ; affx:commonToAll "1" . :Hdh_e19 a affx:Exon ; affx:startsAt "33527297" ; affx:stopsAt "33527395" ; affx:commonToAll "1" . :Hdh_e20 a affx:Exon ; affx:startsAt "33528806" ; affx:stopsAt "33528946" ; affx:commonToAll "1" . :Hdh_e21 a affx:Exon ; affx:startsAt "33530956" ; affx:stopsAt "33531020" ; affx:commonToAll "1" . :Hdh_e22 a affx:Exon ; affx:startsAt "33531453" ; affx:stopsAt "33531554" ; affx:commonToAll "1" . :Hdh_e23 a affx:Exon ; affx:startsAt "33531910" ; affx:stopsAt "33532057" ; affx:commonToAll "1" . :Hdh_e24 a affx:Exon ; affx:startsAt "33533042" ; affx:stopsAt "33533163" ; affx:commonToAll "1" . :Hdh_e25 a affx:Exon ; affx:startsAt "33534350" ; affx:stopsAt "33534427" ; affx:commonToAll "1" . :Hdh_e26 a affx:Exon ; affx:startsAt "33535568" ; affx:stopsAt "33535720" ; affx:commonToAll "1" . :Hdh_e27 a affx:Exon ; affx:startsAt "33536772" ; affx:stopsAt "33536975" ; affx:commonToAll "1" . :Hdh_e28 a affx:Exon ; affx:startsAt "33539731" ; affx:stopsAt "33539858" ; affx:commonToAll "1" . :Hdh_e29 a affx:Exon ; affx:startsAt "33541425" ; affx:stopsAt "33541553" ; affx:commonToAll "1" . :Hdh_e30 a affx:Exon ; affx:startsAt "33549949" ; affx:stopsAt "33550060" ; affx:commonToAll "1" . :Hdh_e31 a affx:Exon ; affx:startsAt "33553148" ; affx:stopsAt "33553226" ; affx:commonToAll "1" . :Hdh_e32 a affx:Exon ; affx:startsAt "33554612" ; affx:stopsAt "33554836" ; affx:commonToAll "1" . :Hdh_e33 a affx:Exon ; affx:startsAt "33555889" ; affx:stopsAt "33555968" ; affx:commonToAll "1" . :Hdh_e34 a affx:Exon ; affx:startsAt "33556095" ; affx:stopsAt "33556257" ; affx:commonToAll "1" . :Hdh_e35 a affx:Exon ; affx:startsAt "33558600" ; affx:stopsAt "33558656" ; affx:commonToAll "1" . :Hdh_e36 a affx:Exon ; affx:startsAt "33559464" ; affx:stopsAt "33559613" ; affx:commonToAll "1" . :Hdh_e37 a affx:Exon ; affx:startsAt "33560141" ; affx:stopsAt "33560278" ; affx:commonToAll "1" . :Hdh_e38 a affx:Exon ; affx:startsAt "33562172" ; affx:stopsAt "33562289" ; affx:commonToAll "1" . :Hdh_e39 a affx:Exon ; affx:startsAt "33571443" ; affx:stopsAt "33571566" ; affx:commonToAll "1" . :Hdh_e40 a affx:Exon ; affx:startsAt "33571843" ; affx:stopsAt "33572076" ; affx:commonToAll "1" . :Hdh_e41 a affx:Exon ; affx:startsAt "33573772" ; affx:stopsAt "33573915" ; affx:commonToAll "1" . :Hdh_e42 a affx:Exon ; affx:startsAt "33577907" ; affx:stopsAt "33578115" ; affx:commonToAll "1" . :Hdh_e43 a affx:Exon ; affx:startsAt "33583103" ; affx:stopsAt "33583245" ; affx:commonToAll "1" . :Hdh_e44 a affx:Exon ; affx:startsAt "33583927" ; affx:stopsAt "33584107" ; affx:commonToAll "1" . :Hdh_e45 a affx:Exon ; affx:startsAt "33584222" ; affx:stopsAt "33584399" ; affx:commonToAll "1" . :Hdh_e46 a affx:Exon ; affx:startsAt "33584625" ; affx:stopsAt "33584702" ; affx:commonToAll "1" . :Hdh_e47 a affx:Exon ; affx:startsAt "33586000" ; affx:stopsAt "33586139" ; affx:commonToAll "1" . :Hdh_e48 a affx:Exon ; affx:startsAt "33587001" ; affx:stopsAt "33587124" ; affx:commonToAll "1" . :Hdh_e49 a affx:Exon ; affx:startsAt "33590047" ; affx:stopsAt "33590261" ; affx:commonToAll "1" . :Hdh_e50 a affx:Exon ; affx:startsAt "33591169" ; affx:stopsAt "33591315" ; affx:commonToAll "1" . :Hdh_e51 a affx:Exon ; affx:startsAt "33592549" ; affx:stopsAt "33592727" ; affx:commonToAll "1" . :Hdh_e52 a affx:Exon ; affx:startsAt "33593702" ; affx:stopsAt "33593798" ; affx:commonToAll "1" . :Hdh_e53 a affx:Exon ; affx:startsAt "33596527" ; affx:stopsAt "33596715" ; affx:commonToAll "1" . :Hdh_e54 a affx:Exon ; affx:startsAt "33598548" ; affx:stopsAt "33598675" ; affx:commonToAll "1" . :Hdh_e55 a affx:Exon ; affx:startsAt "33601542" ; affx:stopsAt "33601643" ; affx:commonToAll "1" . :Hdh_e56 a affx:Exon ; affx:startsAt "33602536" ; affx:stopsAt "33602691" ; affx:commonToAll "1" . :Hdh_e57 a affx:Exon ; affx:startsAt "33603081" ; affx:stopsAt "33603221" ; affx:commonToAll "1" . :Hdh_e58 a affx:Exon ; affx:startsAt "33604085" ; affx:stopsAt "33604168" ; affx:commonToAll "1" . :Hdh_e59 a affx:Exon ; affx:startsAt "33605726" ; affx:stopsAt "33605857" ; affx:commonToAll "1" . :Hdh_e60 a affx:Exon ; affx:startsAt "33605994" ; affx:stopsAt "33606124" ; affx:commonToAll "1" . :Hdh_e61 a affx:Exon ; affx:startsAt "33606969" ; affx:stopsAt "33607125" ; affx:commonToAll "1" . :Hdh_e62 a affx:Exon ; affx:startsAt "33610406" ; affx:stopsAt "33610597" ; affx:commonToAll "1" . :Hdh_e63 a affx:Exon ; affx:startsAt "33612515" ; affx:stopsAt "33612630" ; affx:commonToAll "1" . :Hdh_e64 a affx:Exon ; affx:startsAt "33612732" ; affx:stopsAt "33612946" ; affx:commonToAll "1" . :Hdh_e65 a affx:Exon ; affx:startsAt "33613300" ; affx:stopsAt "33613406" ; affx:commonToAll "1" . :Hdh_e66 a affx:Exon ; affx:startsAt "33614285" ; affx:stopsAt "33614448" ; affx:commonToAll "1" . :Hdh_e67 a affx:Exon ; affx:startsAt "33614634" ; affx:stopsAt "33614795" ; affx:commonToAll "1" . :Hdh_e68 a affx:Exon ; affx:startsAt "33615833" ; affx:stopsAt "33616590" ; affx:commonToAll "0" . :Hdh_e69 a affx:Exon ; affx:startsAt "33615833" ; affx:stopsAt "33616598" ; affx:commonToAll "0" . :HGF a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi220435] ; affx:hasVariant [affx:representedBy :gi220437] . :gi220435 a affx:Transcript ; affx:unigene "iMm.15629" ; affx:translatesTo "MMWGTKLLPVLLLQHVLLHLLLLHVAIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL" ; affx:hasCds [affx:startsAt "14978578" ; affx:stopsAt "15043726" ]; affx:hasExon [ affx:relatesToExon :HGF_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HGF_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HGF_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HGF_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HGF_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e19; affx:cdsType "Partial" ; affx:cdsStop "15043726" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "32" ; affx:spannedBy [ affx:startsAt "14978578" ; affx:stopsAt "14978669" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "14985609" ; affx:stopsAt "14985614" ; affx:inFrame "0" ] ; ] ; ] ; . :gi220437 a affx:Transcript ; affx:unigene "iMm.15629" ; affx:translatesTo "MMWGTKLLPVLLLQHVLLHLLLLHVAIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL" ; affx:hasCds [affx:startsAt "14978578" ; affx:stopsAt "15043726" ]; affx:hasExon [ affx:relatesToExon :HGF_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HGF_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HGF_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HGF_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HGF_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HGF_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :HGF_e19; affx:cdsType "Partial" ; affx:cdsStop "15043726" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "32" ; affx:spannedBy [ affx:startsAt "14978578" ; affx:stopsAt "14978669" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "14985609" ; affx:stopsAt "14985614" ; affx:inFrame "0" ] ; ] ; ] ; . :HGF_e1 a affx:Exon ; affx:startsAt "14978578" ; affx:stopsAt "14978669" ; affx:commonToAll "1" . :HGF_e2 a affx:Exon ; affx:startsAt "14985609" ; affx:stopsAt "14985775" ; affx:commonToAll "1" . :HGF_e3 a affx:Exon ; affx:startsAt "14989437" ; affx:stopsAt "14989550" ; affx:commonToAll "1" . :HGF_e4 a affx:Exon ; affx:startsAt "14991398" ; affx:stopsAt "14991513" ; affx:commonToAll "1" . :HGF_e5 a affx:Exon ; affx:startsAt "14997143" ; affx:stopsAt "14997286" ; affx:commonToAll "0" . :HGF_e6 a affx:Exon ; affx:startsAt "14997158" ; affx:stopsAt "14997286" ; affx:commonToAll "0" . :HGF_e7 a affx:Exon ; affx:startsAt "15001560" ; affx:stopsAt "15001681" ; affx:commonToAll "1" . :HGF_e8 a affx:Exon ; affx:startsAt "15003094" ; affx:stopsAt "15003213" ; affx:commonToAll "1" . :HGF_e9 a affx:Exon ; affx:startsAt "15018495" ; affx:stopsAt "15018670" ; affx:commonToAll "1" . :HGF_e10 a affx:Exon ; affx:startsAt "15022870" ; affx:stopsAt "15022998" ; affx:commonToAll "1" . :HGF_e11 a affx:Exon ; affx:startsAt "15027018" ; affx:stopsAt "15027121" ; affx:commonToAll "1" . :HGF_e12 a affx:Exon ; affx:startsAt "15029523" ; affx:stopsAt "15029657" ; affx:commonToAll "1" . :HGF_e13 a affx:Exon ; affx:startsAt "15034838" ; affx:stopsAt "15034877" ; affx:commonToAll "1" . :HGF_e14 a affx:Exon ; affx:startsAt "15036552" ; affx:stopsAt "15036649" ; affx:commonToAll "1" . :HGF_e15 a affx:Exon ; affx:startsAt "15038488" ; affx:stopsAt "15038563" ; affx:commonToAll "1" . :HGF_e16 a affx:Exon ; affx:startsAt "15039624" ; affx:stopsAt "15039771" ; affx:commonToAll "1" . :HGF_e17 a affx:Exon ; affx:startsAt "15040236" ; affx:stopsAt "15040343" ; affx:commonToAll "1" . :HGF_e18 a affx:Exon ; affx:startsAt "15040462" ; affx:stopsAt "15040608" ; affx:commonToAll "1" . :HGF_e19 a affx:Exon ; affx:startsAt "15043558" ; affx:stopsAt "15043743" ; affx:commonToAll "1" . :J_chain a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi194473] . :gi194473 a affx:Transcript ; affx:unigene "iMm.1192" ; affx:translatesTo "MKTHLLLWGVLAIFVKAVLVTGDDEATILADNKCMCTRVTSRIIPSTEDPNEDIVERNIRIVVPLNNRENISDPTSPLRRNFVYHLSDVCKKCDPVEVELEDQVVTATQSNICNEDDGVPETCYMYDRNKCYTTMVPLRYHGETKMVQAALTPDSCYPD" ; affx:hasCds [affx:startsAt "88126999" ; affx:stopsAt "88133466" ]; affx:hasExon [ affx:relatesToExon :J_chain_e1; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :J_chain_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :J_chain_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :J_chain_e4; affx:cdsType "Partial" ; affx:cdsStop "88133466" ; affx:frame "0"] ; . :J_chain_e1 a affx:Exon ; affx:startsAt "88126999" ; affx:stopsAt "88127213" ; affx:commonToAll "1" . :J_chain_e2 a affx:Exon ; affx:startsAt "88128179" ; affx:stopsAt "88128260" ; affx:commonToAll "1" . :J_chain_e3 a affx:Exon ; affx:startsAt "88131785" ; affx:stopsAt "88131906" ; affx:commonToAll "1" . :J_chain_e4 a affx:Exon ; affx:startsAt "88133402" ; affx:stopsAt "88133487" ; affx:commonToAll "1" . :Gene4990 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi200338] . :gi200338 a affx:Transcript ; affx:unigene "iMm.3159" ; affx:translatesTo "MTRDDALPDSHSAQTFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEVQELREATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLTEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLQPGEKLREVCGTPSYLAPEIIQCSMDDGHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMDGKYQFGSPEWDDYSDTVKDLVSRFLVVQPQDRCSAEEALAHPFFQEYVVEEVRHFSPRGKFKVICLTVLASVKIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEEDF" ; affx:hasCds [affx:startsAt "128288469" ; affx:stopsAt "128298337" ]; affx:hasExon [ affx:relatesToExon :Gene4990_e1; affx:cdsType "Partial" ; affx:cdsStart "128288469" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4990_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4990_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4990_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4990_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4990_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4990_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4990_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4990_e9; affx:cdsType "Partial" ; affx:cdsStop "128298337" ; affx:frame "1"] ; . :Gene4990_e1 a affx:Exon ; affx:startsAt "128287470" ; affx:stopsAt "128288718" ; affx:commonToAll "1" . :Gene4990_e2 a affx:Exon ; affx:startsAt "128289003" ; affx:stopsAt "128289129" ; affx:commonToAll "1" . :Gene4990_e3 a affx:Exon ; affx:startsAt "128289945" ; affx:stopsAt "128290099" ; affx:commonToAll "1" . :Gene4990_e4 a affx:Exon ; affx:startsAt "128290224" ; affx:stopsAt "128290315" ; affx:commonToAll "1" . :Gene4990_e5 a affx:Exon ; affx:startsAt "128290890" ; affx:stopsAt "128291054" ; affx:commonToAll "1" . :Gene4990_e6 a affx:Exon ; affx:startsAt "128293493" ; affx:stopsAt "128293559" ; affx:commonToAll "1" . :Gene4990_e7 a affx:Exon ; affx:startsAt "128297248" ; affx:stopsAt "128297303" ; affx:commonToAll "1" . :Gene4990_e8 a affx:Exon ; affx:startsAt "128297701" ; affx:stopsAt "128297880" ; affx:commonToAll "1" . :Gene4990_e9 a affx:Exon ; affx:startsAt "128298254" ; affx:stopsAt "128298377" ; affx:commonToAll "1" . :NRSF_REST a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18146802] . :gi18146802 a affx:Transcript ; affx:unigene "iMm.117547" ; affx:translatesTo "MATQVMGQSSGGGSLFNNSANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGEERQMAELMPVGDNHFSESEGEGLEESADLKGLENMELGSLELSAVEPQPVFEASAAPEIYSANKDPAPETPVAEDKCRSSKAKPFRCKPCQYEAESEEQFVHHIRIHSAKKFFVEESAEKQAKAWESGSSPAEEGEFSKGPIRCDRCGYNTNRYDHYMAHLKHHLRAGENERIYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCSKCNYFSDRKNNYVQHVRTHTGERPYKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCNYVASNQHEVTRHARQVHNGPKPLNCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPSKTMDVSKVKLKKTKKREADLLNNAVSNEKMENEQTKTKGDVSGKKNEKPVKAVGKDASKEKKPGSSVSVVQVTTRTRKSAVAAETKAAEVKHTDGQTGNNPEKPCKAKKNKRKKDAEAHPSEEPVNEGPVTKKKKKSECKSKIGTNVPKGGGRAEERPGVKKQSASLKKGTKKTPPKTKTSKKGGKLAPKGMGQTEPSSGALAQVGVSPDPALIQAEVTGSGSSQTELPSPMDIAKSEPAQMEVSLTGPPPVEPAQMEPSPAKPPQVEAPTYPQPPQRGPAPPTGPAPPTGPAPPTEPAPPTGLAEMEPSPTEPSQKEPPPSMEPPCPEELPQAEPPPMEDCQKELPSPVEPAQIEVAQTAPTQVQEEPPPVSEPPRVKPTKRSSLRKDRAEKELSLLSEMARQEQVLMGVGLVPVRDSKLLKGNKSAQDPPAPPSPSPKGNSREETPKDQEMVSDGEGTIVFPLKKGGPEEAGESPAELAALKESARVSSSEQNSAMPEGGASHSKCQTGSSGLCDVDTEQKTDTVPMKDSAAEPVSPPTPTVDRDAGSPAVVASPPITLAENESQEIDEDEGIHSHDGSDLSDNMSEGSDDSGLHGARPTPPEATSKNGKAGLAGKVTEGEFVCIFCDRSFRKEKDYSKHLNRHLVNVYFLEEAAEEQEEQEEREEQE" ; affx:hasCds [affx:startsAt "76787285" ; affx:stopsAt "76802329" ]; affx:hasExon [ affx:relatesToExon :NRSF_REST_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :NRSF_REST_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :NRSF_REST_e3; affx:cdsType "Full" ; affx:frame "1"] ; . :NRSF_REST_e1 a affx:Exon ; affx:startsAt "76787285" ; affx:stopsAt "76788168" ; affx:commonToAll "1" . :NRSF_REST_e2 a affx:Exon ; affx:startsAt "76794578" ; affx:stopsAt "76794662" ; affx:commonToAll "1" . :NRSF_REST_e3 a affx:Exon ; affx:startsAt "76800047" ; affx:stopsAt "76802329" ; affx:commonToAll "1" . :Gene4992 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi5736625] . :gi5736625 a affx:Transcript ; affx:unigene "iMm.44784" ; affx:translatesTo "MQAAAAASFWLLCVLGTCPLARCGRAGVASLKGLERGKENRFLERQSIIPLRLIYRLGGEDETQHNQLDTRVRGDPGGPQLTHVDKASFRVDAFGTSFVLDVLLNHELLSSGYVERQIEHGGKVVENKGGEHCYYQGQIRGNPVSFVALSTCHGLHGMFYDGNHTYLIEPEENEKSQESSHCHSVYKSRQFEFPLDDLPSEFQRVNITPPQFILKPRLKRRKRQLLRFPRNVEEETKYIELMIVNDHLMFKKHRLSVVYTNTYAKSVVNMADVIYKDQLKTRIVLVAMETWAADNKFAISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGICSLLRGGGVNEFGKTDLMAVTLAQSLAHNVGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNVEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECALEGAECCKKCTLTQDSQCSDGLCCKKCKFQPLGTVCREAVNDCDIREICSGNSSQCAPNVHKMDGYSCDGTQGICFGGRCKTRDRQCKYIWGQKVTASDRYCYEKLNIEGTEKGNCGKDKDTWTQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGAHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCSSSKAGTVCSGNGVCSNELKCVCNRHWTGADCGTHFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGDGDSFYSDFPPGGSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNMGGNKKKIRGKRFRPRSNSTE" ; affx:hasCds [affx:startsAt "5500770" ; affx:stopsAt "5769573" ]; affx:hasExon [ affx:relatesToExon :Gene4992_e1; affx:cdsType "Partial" ; affx:cdsStart "5500770" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e19; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e21; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e22; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e24; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e25; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e26; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e27; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e28; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4992_e29; affx:cdsType "Partial" ; affx:cdsStop "5769573" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "23" ; affx:spannedBy [ affx:startsAt "5500770" ; affx:stopsAt "5500839" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "735" ; affx:stopsAt "757" ; affx:spannedBy [ affx:startsAt "5749735" ; affx:stopsAt "5749801" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene4992_e1 a affx:Exon ; affx:startsAt "5500647" ; affx:stopsAt "5500849" ; affx:commonToAll "1" . :Gene4992_e2 a affx:Exon ; affx:startsAt "5501363" ; affx:stopsAt "5501524" ; affx:commonToAll "1" . :Gene4992_e3 a affx:Exon ; affx:startsAt "5537671" ; affx:stopsAt "5537748" ; affx:commonToAll "1" . :Gene4992_e4 a affx:Exon ; affx:startsAt "5631210" ; affx:stopsAt "5631277" ; affx:commonToAll "1" . :Gene4992_e5 a affx:Exon ; affx:startsAt "5694380" ; affx:stopsAt "5694463" ; affx:commonToAll "1" . :Gene4992_e6 a affx:Exon ; affx:startsAt "5701024" ; affx:stopsAt "5701088" ; affx:commonToAll "1" . :Gene4992_e7 a affx:Exon ; affx:startsAt "5702927" ; affx:stopsAt "5702997" ; affx:commonToAll "1" . :Gene4992_e8 a affx:Exon ; affx:startsAt "5709374" ; affx:stopsAt "5709445" ; affx:commonToAll "1" . :Gene4992_e9 a affx:Exon ; affx:startsAt "5712541" ; affx:stopsAt "5712616" ; affx:commonToAll "1" . :Gene4992_e10 a affx:Exon ; affx:startsAt "5715072" ; affx:stopsAt "5715144" ; affx:commonToAll "1" . :Gene4992_e11 a affx:Exon ; affx:startsAt "5715879" ; affx:stopsAt "5716046" ; affx:commonToAll "1" . :Gene4992_e12 a affx:Exon ; affx:startsAt "5717293" ; affx:stopsAt "5717378" ; affx:commonToAll "1" . :Gene4992_e13 a affx:Exon ; affx:startsAt "5718466" ; affx:stopsAt "5718557" ; affx:commonToAll "1" . :Gene4992_e14 a affx:Exon ; affx:startsAt "5719828" ; affx:stopsAt "5719880" ; affx:commonToAll "1" . :Gene4992_e15 a affx:Exon ; affx:startsAt "5724693" ; affx:stopsAt "5724793" ; affx:commonToAll "1" . :Gene4992_e16 a affx:Exon ; affx:startsAt "5726714" ; affx:stopsAt "5726786" ; affx:commonToAll "1" . :Gene4992_e17 a affx:Exon ; affx:startsAt "5726994" ; affx:stopsAt "5727087" ; affx:commonToAll "1" . :Gene4992_e18 a affx:Exon ; affx:startsAt "5729119" ; affx:stopsAt "5729200" ; affx:commonToAll "1" . :Gene4992_e19 a affx:Exon ; affx:startsAt "5731063" ; affx:stopsAt "5731114" ; affx:commonToAll "1" . :Gene4992_e20 a affx:Exon ; affx:startsAt "5731326" ; affx:stopsAt "5731390" ; affx:commonToAll "1" . :Gene4992_e21 a affx:Exon ; affx:startsAt "5734267" ; affx:stopsAt "5734373" ; affx:commonToAll "1" . :Gene4992_e22 a affx:Exon ; affx:startsAt "5740532" ; affx:stopsAt "5740652" ; affx:commonToAll "1" . :Gene4992_e23 a affx:Exon ; affx:startsAt "5743942" ; affx:stopsAt "5744111" ; affx:commonToAll "1" . :Gene4992_e24 a affx:Exon ; affx:startsAt "5745040" ; affx:stopsAt "5745155" ; affx:commonToAll "1" . :Gene4992_e25 a affx:Exon ; affx:startsAt "5749715" ; affx:stopsAt "5749806" ; affx:commonToAll "1" . :Gene4992_e26 a affx:Exon ; affx:startsAt "5754888" ; affx:stopsAt "5754906" ; affx:commonToAll "1" . :Gene4992_e27 a affx:Exon ; affx:startsAt "5766728" ; affx:stopsAt "5766836" ; affx:commonToAll "1" . :Gene4992_e28 a affx:Exon ; affx:startsAt "5769077" ; affx:stopsAt "5769178" ; affx:commonToAll "1" . :Gene4992_e29 a affx:Exon ; affx:startsAt "5769502" ; affx:stopsAt "5769649" ; affx:commonToAll "1" . :Gene4993 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi3061281] . :gi3061281 a affx:Transcript ; affx:unigene "iMm.4149" ; affx:translatesTo "MGDTFIRHIALLGFEKRFIPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPIEAGEIHTENRVIPHLPAPRWFDGQRAAESRQGTLTEYFNGLMGLPVKISRCPHLLDFFKVRPDDLKLPTDSQAKKPETYLVPKDGKNNVADITGPIILQTYRAIADYEKSSGTEMTVATGDVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYAGEPYVTIKAYAAVEEDEMSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRGRGAPPRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPGRPGPLSTDGTKDNPSTPRVKPQPAVPPRPSSDLILHRCTESTKRKLTSAV" ; affx:hasCds [affx:startsAt "132824383" ; affx:stopsAt "132832247" ]; affx:hasExon [ affx:relatesToExon :Gene4993_e1; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4993_e11; affx:cdsType "Partial" ; affx:cdsStop "132832247" ; affx:frame "2"] ; . :Gene4993_e1 a affx:Exon ; affx:startsAt "132824383" ; affx:stopsAt "132824502" ; affx:commonToAll "1" . :Gene4993_e2 a affx:Exon ; affx:startsAt "132824663" ; affx:stopsAt "132824809" ; affx:commonToAll "1" . :Gene4993_e3 a affx:Exon ; affx:startsAt "132825315" ; affx:stopsAt "132825423" ; affx:commonToAll "1" . :Gene4993_e4 a affx:Exon ; affx:startsAt "132826029" ; affx:stopsAt "132826147" ; affx:commonToAll "1" . :Gene4993_e5 a affx:Exon ; affx:startsAt "132827869" ; affx:stopsAt "132827977" ; affx:commonToAll "1" . :Gene4993_e6 a affx:Exon ; affx:startsAt "132828308" ; affx:stopsAt "132828431" ; affx:commonToAll "1" . :Gene4993_e7 a affx:Exon ; affx:startsAt "132829218" ; affx:stopsAt "132829274" ; affx:commonToAll "1" . :Gene4993_e8 a affx:Exon ; affx:startsAt "132829782" ; affx:stopsAt "132829948" ; affx:commonToAll "1" . :Gene4993_e9 a affx:Exon ; affx:startsAt "132830083" ; affx:stopsAt "132830159" ; affx:commonToAll "1" . :Gene4993_e10 a affx:Exon ; affx:startsAt "132830708" ; affx:stopsAt "132830789" ; affx:commonToAll "1" . :Gene4993_e11 a affx:Exon ; affx:startsAt "132832175" ; affx:stopsAt "132832284" ; affx:commonToAll "1" . :mimp3 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi11933383] . :gi11933383 a affx:Transcript ; affx:unigene "iMm.18496" ; affx:translatesTo "MNKLYIGNLSDHAGPADLESVFKDAKIPVAGPFLVKTGYAFVDCPDEGWALKAIEALSGKMELHGKPMEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDETAAQQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENTGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGSVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSTLTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQSLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK" ; affx:hasCds [affx:startsAt "49438249" ; affx:stopsAt "49566379" ]; affx:hasExon [ affx:relatesToExon :mimp3_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :mimp3_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :mimp3_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :mimp3_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :mimp3_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :mimp3_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :mimp3_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :mimp3_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :mimp3_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :mimp3_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :mimp3_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :mimp3_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :mimp3_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :mimp3_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :mimp3_e15; affx:cdsType "Full" ; affx:frame "0"] ; . :mimp3_e1 a affx:Exon ; affx:startsAt "49438249" ; affx:stopsAt "49438348" ; affx:commonToAll "1" . :mimp3_e2 a affx:Exon ; affx:startsAt "49438675" ; affx:stopsAt "49438789" ; affx:commonToAll "1" . :mimp3_e3 a affx:Exon ; affx:startsAt "49439337" ; affx:stopsAt "49439469" ; affx:commonToAll "1" . :mimp3_e4 a affx:Exon ; affx:startsAt "49441883" ; affx:stopsAt "49441958" ; affx:commonToAll "1" . :mimp3_e5 a affx:Exon ; affx:startsAt "49445047" ; affx:stopsAt "49445164" ; affx:commonToAll "1" . :mimp3_e6 a affx:Exon ; affx:startsAt "49455087" ; affx:stopsAt "49455213" ; affx:commonToAll "1" . :mimp3_e7 a affx:Exon ; affx:startsAt "49456483" ; affx:stopsAt "49456619" ; affx:commonToAll "1" . :mimp3_e8 a affx:Exon ; affx:startsAt "49458255" ; affx:stopsAt "49458378" ; affx:commonToAll "1" . :mimp3_e9 a affx:Exon ; affx:startsAt "49459839" ; affx:stopsAt "49459974" ; affx:commonToAll "1" . :mimp3_e10 a affx:Exon ; affx:startsAt "49468808" ; affx:stopsAt "49469090" ; affx:commonToAll "1" . :mimp3_e11 a affx:Exon ; affx:startsAt "49486364" ; affx:stopsAt "49486428" ; affx:commonToAll "1" . :mimp3_e12 a affx:Exon ; affx:startsAt "49486516" ; affx:stopsAt "49486568" ; affx:commonToAll "1" . :mimp3_e13 a affx:Exon ; affx:startsAt "49520147" ; affx:stopsAt "49520196" ; affx:commonToAll "1" . :mimp3_e14 a affx:Exon ; affx:startsAt "49565174" ; affx:stopsAt "49565235" ; affx:commonToAll "1" . :mimp3_e15 a affx:Exon ; affx:startsAt "49566204" ; affx:stopsAt "49566379" ; affx:commonToAll "1" . :Snrpg a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13385993] . :gi13385993 a affx:Transcript ; affx:unigene "iMm.21764" ; affx:translatesTo "MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV" ; affx:hasCds [affx:startsAt "87228797" ; affx:stopsAt "87235998" ]; affx:hasExon [ affx:relatesToExon :Snrpg_e1; affx:cdsType "Partial" ; affx:cdsStart "87228797" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Snrpg_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Snrpg_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Snrpg_e4; affx:cdsType "Partial" ; affx:cdsStop "87235998" ; affx:frame "0"] ; . :Snrpg_e1 a affx:Exon ; affx:startsAt "87228754" ; affx:stopsAt "87228829" ; affx:commonToAll "1" . :Snrpg_e2 a affx:Exon ; affx:startsAt "87232891" ; affx:stopsAt "87232914" ; affx:commonToAll "1" . :Snrpg_e3 a affx:Exon ; affx:startsAt "87233709" ; affx:stopsAt "87233834" ; affx:commonToAll "1" . :Snrpg_e4 a affx:Exon ; affx:startsAt "87235947" ; affx:stopsAt "87236117" ; affx:commonToAll "1" . :Cntnap2 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13385239] . :gi13385239 a affx:Transcript ; affx:unigene "iMm.45210" ; affx:translatesTo "MSSATDPWHLDHLDSASADFPYNPGQGQAIRNGVNRNSAIIGGVIAVVIFTILCTLVFLIRYMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFTETIDESKKEWLI" ; affx:hasCds [affx:startsAt "47524905" ; affx:stopsAt "47552418" ]; affx:hasExon [ affx:relatesToExon :Cntnap2_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Cntnap2_e2; affx:cdsType "Partial" ; affx:cdsStart "47524905" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Cntnap2_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Cntnap2_e4; affx:cdsType "Partial" ; affx:cdsStop "47552418" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "38" ; affx:stopsAt "60" ; affx:spannedBy [ affx:startsAt "47550590" ; affx:stopsAt "47550603" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "47552218" ; affx:stopsAt "47552271" ; affx:inFrame "1" ] ; ] ; ] ; . :Cntnap2_e1 a affx:Exon ; affx:startsAt "47497972" ; affx:stopsAt "47498120" ; affx:commonToAll "1" . :Cntnap2_e2 a affx:Exon ; affx:startsAt "47524711" ; affx:stopsAt "47524951" ; affx:commonToAll "1" . :Cntnap2_e3 a affx:Exon ; affx:startsAt "47550522" ; affx:stopsAt "47550603" ; affx:commonToAll "1" . :Cntnap2_e4 a affx:Exon ; affx:startsAt "47552218" ; affx:stopsAt "47553116" ; affx:commonToAll "1" . :Timp4 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi18079345] . :gi18079345 a affx:Transcript ; affx:unigene "iMm.36851" ; affx:translatesTo "MPWSPLAALSWALVLRLLALLWPPGRGEACSCAPAHPQQHFCHSALVIRAKISSEKVVPASKDPADTQKLIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSHKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIIQP" ; affx:hasCds [affx:startsAt "116028192" ; affx:stopsAt "116033685" ]; affx:hasExon [ affx:relatesToExon :Timp4_e1; affx:cdsType "Partial" ; affx:cdsStart "116028192" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Timp4_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Timp4_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Timp4_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Timp4_e5; affx:cdsType "Partial" ; affx:cdsStop "116033685" ; affx:frame "0"] ; . :Timp4_e1 a affx:Exon ; affx:startsAt "116027929" ; affx:stopsAt "116028390" ; affx:commonToAll "1" . :Timp4_e2 a affx:Exon ; affx:startsAt "116029136" ; affx:stopsAt "116029261" ; affx:commonToAll "1" . :Timp4_e3 a affx:Exon ; affx:startsAt "116031735" ; affx:stopsAt "116031850" ; affx:commonToAll "1" . :Timp4_e4 a affx:Exon ; affx:startsAt "116032286" ; affx:stopsAt "116032384" ; affx:commonToAll "1" . :Timp4_e5 a affx:Exon ; affx:startsAt "116033546" ; affx:stopsAt "116033687" ; affx:commonToAll "1" . :cml2 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi8886498] . :gi8886498 a affx:Transcript ; affx:unigene "iMm.24251" ; affx:translatesTo "MAAYHIRQYQEKDHKRVLELFSSGMKELIPAAIRQMLTLPHSLLLLPGVPVTIVLMSASWLLATLYSFLFLLCLWLIFWISCRNYVAKSLQADLADITKSYLNAHGSFWVAESGDQVVGMVGAQPVKDPPLGKKQMQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYSDVVLETGSVQHSAQALYQAMGFQKTGQYFVSISKKLMGLSILQFSYSLPFASGPGYSGKYLKKGPIPC" ; affx:hasCds [affx:startsAt "86726539" ; affx:stopsAt "86727256" ]; affx:hasExon [ affx:relatesToExon :cml2_e1; affx:cdsType "Partial" ; affx:cdsStart "86726539" ; affx:cdsStop "86727256" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :cml2_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :cml2_e3; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "69" ; affx:spannedBy [ affx:startsAt "86727049" ; affx:stopsAt "86727256" ; affx:inFrame "2" ] ; ] ; ] ; . :cml2_e1 a affx:Exon ; affx:startsAt "86726477" ; affx:stopsAt "86727330" ; affx:commonToAll "1" . :cml2_e2 a affx:Exon ; affx:startsAt "86727656" ; affx:stopsAt "86727801" ; affx:commonToAll "1" . :cml2_e3 a affx:Exon ; affx:startsAt "86727911" ; affx:stopsAt "86727993" ; affx:commonToAll "1" . :Cml3 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16716390] . :gi16716390 a affx:Transcript ; affx:unigene "iMm.154781" ; affx:translatesTo "MAPYHIRKYQGSDHRSVVDLFRRGMEEHIPATFRHMLLLPRTLLLLLGVPLTLFLASGSWLLVLLSILTLFLSLWFLAKYTWEKHVMNCLHTDMADITRTYLSSHSSCFWVAESRGQTVGMVAARPVKDPLLQKKQLQLLHLSVSLQHRREGLGKAMVRTVLQFAQMQGFSEVVLSTSMLQYAALALYQGMGFQKTGETFYTYLSRLRKSPMINLKYSLTSREGDL" ; affx:hasCds [affx:startsAt "86666588" ; affx:stopsAt "86667270" ]; affx:hasExon [ affx:relatesToExon :Cml3_e1; affx:cdsType "Partial" ; affx:cdsStop "86667025" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Cml3_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Cml3_e3; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "37" ; affx:stopsAt "56" ; affx:spannedBy [ affx:startsAt "86667102" ; affx:stopsAt "86667159" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "60" ; affx:stopsAt "77" ; affx:spannedBy [ affx:startsAt "86667039" ; affx:stopsAt "86667090" ; affx:inFrame "0" ] ; ] ; ] ; . :Cml3_e1 a affx:Exon ; affx:startsAt "86666588" ; affx:stopsAt "86667344" ; affx:commonToAll "1" . :Cml3_e2 a affx:Exon ; affx:startsAt "86667708" ; affx:stopsAt "86667833" ; affx:commonToAll "1" . :Cml3_e3 a affx:Exon ; affx:startsAt "86667924" ; affx:stopsAt "86667969" ; affx:commonToAll "1" . :C1galt1-pending a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16506276] . :gi16506276 a affx:Transcript ; affx:unigene "iMm.102752" ; affx:translatesTo "MASKSWLNFLVFLCGSAIGFFLCSQLLSILLREEAAIQPNMLHNDPHARHSDDNGHSHLKGQMNFNADSSQHKDENIDVAENLYQKVKILCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENQDFPTVGLKTKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVIVDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVNAFKTEKCTHSSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPIEGPGCCSDIAVSFHYVDGTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNRKEDTKIKLGNP" ; affx:hasCds [affx:startsAt "7614424" ; affx:stopsAt "7621760" ]; affx:hasExon [ affx:relatesToExon :C1galt1-pending_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :C1galt1-pending_e2; affx:cdsType "Partial" ; affx:cdsStart "7614424" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :C1galt1-pending_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :C1galt1-pending_e4; affx:cdsType "Partial" ; affx:cdsStop "7621760" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "36" ; affx:spannedBy [ affx:startsAt "7614424" ; affx:stopsAt "7614532" ; affx:inFrame "0" ] ; ] ; ] ; . :C1galt1-pending_e1 a affx:Exon ; affx:startsAt "7595764" ; affx:stopsAt "7595895" ; affx:commonToAll "1" . :C1galt1-pending_e2 a affx:Exon ; affx:startsAt "7614407" ; affx:stopsAt "7614644" ; affx:commonToAll "1" . :C1galt1-pending_e3 a affx:Exon ; affx:startsAt "7616878" ; affx:stopsAt "7617546" ; affx:commonToAll "1" . :C1galt1-pending_e4 a affx:Exon ; affx:startsAt "7621556" ; affx:stopsAt "7621958" ; affx:commonToAll "1" . :Foxp2 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi14582801] . :gi14582801 a affx:Transcript ; affx:unigene "iMm.133208" ; affx:translatesTo "MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQAARQLLLQQQTSGLKSPKSSEKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGKQAKEQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSTTSKASPPITHHSIVNGQSSVLNARRDSSSHEETGASHTLYGHGVCKWPGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSDKYNIPMSSEIAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPTSLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE" ; affx:hasCds [affx:startsAt "14987849" ; affx:stopsAt "15229176" ]; affx:hasExon [ affx:relatesToExon :Foxp2_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp2_e16; affx:cdsType "Full" ; affx:frame "1"] ; . :Foxp2_e1 a affx:Exon ; affx:startsAt "14987849" ; affx:stopsAt "14988017" ; affx:commonToAll "1" . :Foxp2_e2 a affx:Exon ; affx:startsAt "15077573" ; affx:stopsAt "15077663" ; affx:commonToAll "1" . :Foxp2_e3 a affx:Exon ; affx:startsAt "15167829" ; affx:stopsAt "15167967" ; affx:commonToAll "1" . :Foxp2_e4 a affx:Exon ; affx:startsAt "15169028" ; affx:stopsAt "15169229" ; affx:commonToAll "1" . :Foxp2_e5 a affx:Exon ; affx:startsAt "15170793" ; affx:stopsAt "15170968" ; affx:commonToAll "1" . :Foxp2_e6 a affx:Exon ; affx:startsAt "15185793" ; affx:stopsAt "15186007" ; affx:commonToAll "1" . :Foxp2_e7 a affx:Exon ; affx:startsAt "15187892" ; affx:stopsAt "15187997" ; affx:commonToAll "1" . :Foxp2_e8 a affx:Exon ; affx:startsAt "15194971" ; affx:stopsAt "15195059" ; affx:commonToAll "1" . :Foxp2_e9 a affx:Exon ; affx:startsAt "15196713" ; affx:stopsAt "15196797" ; affx:commonToAll "1" . :Foxp2_e10 a affx:Exon ; affx:startsAt "15200895" ; affx:stopsAt "15201097" ; affx:commonToAll "1" . :Foxp2_e11 a affx:Exon ; affx:startsAt "15202180" ; affx:stopsAt "15202257" ; affx:commonToAll "1" . :Foxp2_e12 a affx:Exon ; affx:startsAt "15202396" ; affx:stopsAt "15202498" ; affx:commonToAll "1" . :Foxp2_e13 a affx:Exon ; affx:startsAt "15204955" ; affx:stopsAt "15205077" ; affx:commonToAll "1" . :Foxp2_e14 a affx:Exon ; affx:startsAt "15206189" ; affx:stopsAt "15206259" ; affx:commonToAll "1" . :Foxp2_e15 a affx:Exon ; affx:startsAt "15207024" ; affx:stopsAt "15207188" ; affx:commonToAll "1" . :Foxp2_e16 a affx:Exon ; affx:startsAt "15229031" ; affx:stopsAt "15229176" ; affx:commonToAll "1" . :D6Mm5e a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi14861845] . :gi14861845 a affx:Transcript ; affx:unigene "iMm.100652" ; affx:translatesTo "MNRRKTTSRGTSAAMKISHQPPRLLIVNIAVPSWVDICPNLCEALQNFFSIACSLMGPSRMSLFSLYTVQNQHECVLPFVQVRGNFIRLQACISELRMLQVEGCHRPPHALLPLAIEDGLQQFKQYSSHMASSAAQPWTSLEITVLTSRPGKEVVKELEEGLKDINLLSVRRLQVAEVTKGIQERSDSPSPTEEPSNDESSILEADIVLETLDNDVVSMEVFFKAWLHNSETDQENIHLLLTPQSLPPPSRAKDHPICLKCDLQERFLSPSLLPGTADGVSRIDDPKGDISTLYQMASLASASPYKLQVVKALKSSGICESLTYGLPFILRPTSCWQLDWDELETNQQHFHALCHCLLKRDWLLLARGEPLIHKHNQSLPACSFYVITPSHSLTLLVKLVATRELMLPGFFPLLSEDPPEDSLKIIESTLDSLDLGLTYNPLHVGSHLYSHLSSAHAKPQGRLYTSCASRGLRKGGQLQTNRVRAAVVPLPVAPAPRRALKMTAASKASSAAFLPSDSEEGEEERPSHT" ; affx:hasCds [affx:startsAt "83843792" ; affx:stopsAt "83918065" ]; affx:hasExon [ affx:relatesToExon :D6Mm5e_e1; affx:cdsType "Partial" ; affx:cdsStart "83843792" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :D6Mm5e_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :D6Mm5e_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :D6Mm5e_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :D6Mm5e_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :D6Mm5e_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :D6Mm5e_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :D6Mm5e_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :D6Mm5e_e9; affx:cdsType "Partial" ; affx:cdsStop "83918065" ; affx:frame "2"] ; . :D6Mm5e_e1 a affx:Exon ; affx:startsAt "83843734" ; affx:stopsAt "83844032" ; affx:commonToAll "1" . :D6Mm5e_e2 a affx:Exon ; affx:startsAt "83855251" ; affx:stopsAt "83855437" ; affx:commonToAll "1" . :D6Mm5e_e3 a affx:Exon ; affx:startsAt "83869065" ; affx:stopsAt "83869234" ; affx:commonToAll "1" . :D6Mm5e_e4 a affx:Exon ; affx:startsAt "83890979" ; affx:stopsAt "83891153" ; affx:commonToAll "1" . :D6Mm5e_e5 a affx:Exon ; affx:startsAt "83892755" ; affx:stopsAt "83892918" ; affx:commonToAll "1" . :D6Mm5e_e6 a affx:Exon ; affx:startsAt "83893567" ; affx:stopsAt "83893709" ; affx:commonToAll "1" . :D6Mm5e_e7 a affx:Exon ; affx:startsAt "83914325" ; affx:stopsAt "83914532" ; affx:commonToAll "1" . :D6Mm5e_e8 a affx:Exon ; affx:startsAt "83916519" ; affx:stopsAt "83916660" ; affx:commonToAll "1" . :D6Mm5e_e9 a affx:Exon ; affx:startsAt "83917897" ; affx:stopsAt "83918295" ; affx:commonToAll "1" . :Tsga14 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi14030772] . :gi14030772 a affx:Transcript ; affx:unigene "iMm.27751" ; affx:translatesTo "MSARRHIGNPEYLTRRIPQNPRYQHVKSRLDTGNSMTKYIEKLEEIKKNYRYKKDELFKRLKVTTFAQLVIQVASLSDQTLEVTAEEIQRLEDNDSATSEADAEIAAKTNGKGSPEEQSPSPVQFINSTGAGDSSRSTLQSVISGVGELDVDKGLVKKEEPNGKDKPYPDCPFLLLDVRDRDSYQQCHIVGAYSYPIATLSRTMNPYSNDILEYKNAHGKIIILYDEDERLASQAATTMCERGFENLFMLSGGLKVLAQKFPEGLVTGSLPASCQQALPFGSVRKRRGPKMPALPAENKWRFTPEDLKKIECYLEEDQGPADNPSRLNQNNSAGKDSKVAACRGGQNLPTSCPASHSSPRTLTSGHLQGKPWK" ; affx:hasCds [affx:startsAt "30671589" ; affx:stopsAt "30710160" ]; affx:hasExon [ affx:relatesToExon :Tsga14_e1; affx:cdsType "Partial" ; affx:cdsStart "30671589" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tsga14_e11; affx:cdsType "Partial" ; affx:cdsStop "30710160" ; affx:frame "2"] ; . :Tsga14_e1 a affx:Exon ; affx:startsAt "30670279" ; affx:stopsAt "30671738" ; affx:commonToAll "1" . :Tsga14_e2 a affx:Exon ; affx:startsAt "30672439" ; affx:stopsAt "30672655" ; affx:commonToAll "1" . :Tsga14_e3 a affx:Exon ; affx:startsAt "30673258" ; affx:stopsAt "30673373" ; affx:commonToAll "1" . :Tsga14_e4 a affx:Exon ; affx:startsAt "30674317" ; affx:stopsAt "30674385" ; affx:commonToAll "1" . :Tsga14_e5 a affx:Exon ; affx:startsAt "30674733" ; affx:stopsAt "30674885" ; affx:commonToAll "1" . :Tsga14_e6 a affx:Exon ; affx:startsAt "30676832" ; affx:stopsAt "30676977" ; affx:commonToAll "1" . :Tsga14_e7 a affx:Exon ; affx:startsAt "30682230" ; affx:stopsAt "30682300" ; affx:commonToAll "1" . :Tsga14_e8 a affx:Exon ; affx:startsAt "30683344" ; affx:stopsAt "30683406" ; affx:commonToAll "1" . :Tsga14_e9 a affx:Exon ; affx:startsAt "30687286" ; affx:stopsAt "30687334" ; affx:commonToAll "1" . :Tsga14_e10 a affx:Exon ; affx:startsAt "30696094" ; affx:stopsAt "30696158" ; affx:commonToAll "1" . :Tsga14_e11 a affx:Exon ; affx:startsAt "30710127" ; affx:stopsAt "30710203" ; affx:commonToAll "1" . :M6pr a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi14916478] . :gi14916478 a affx:Transcript ; affx:unigene "iMm.1358" ; affx:translatesTo "MFPFSGCWRTELLLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKSFESTVGQGSDTYSYIFRVCREASNHSSGAGLVQINKSNDKETVVGRINETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLAANFNPVSEERGKVQDCFYLFEMDSSLACSPEVSHLSVGSILLVIFASLVAVYIIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM" ; affx:hasCds [affx:startsAt "123357157" ; affx:stopsAt "123361373" ]; affx:hasExon [ affx:relatesToExon :M6pr_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :M6pr_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :M6pr_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :M6pr_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :M6pr_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :M6pr_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "27" ; affx:spannedBy [ affx:startsAt "123357157" ; affx:stopsAt "123357238" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "189" ; affx:stopsAt "211" ; affx:spannedBy [ affx:startsAt "123360337" ; affx:stopsAt "123360357" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "123360972" ; affx:stopsAt "123361018" ; affx:inFrame "2" ] ; ] ; ] ; . :M6pr_e1 a affx:Exon ; affx:startsAt "123357157" ; affx:stopsAt "123357336" ; affx:commonToAll "1" . :M6pr_e2 a affx:Exon ; affx:startsAt "123358181" ; affx:stopsAt "123358348" ; affx:commonToAll "1" . :M6pr_e3 a affx:Exon ; affx:startsAt "123359979" ; affx:stopsAt "123360089" ; affx:commonToAll "1" . :M6pr_e4 a affx:Exon ; affx:startsAt "123360226" ; affx:stopsAt "123360357" ; affx:commonToAll "1" . :M6pr_e5 a affx:Exon ; affx:startsAt "123360972" ; affx:stopsAt "123361099" ; affx:commonToAll "1" . :M6pr_e6 a affx:Exon ; affx:startsAt "123361250" ; affx:stopsAt "123361373" ; affx:commonToAll "1" . :Gene5005 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi12831198] ; affx:hasVariant [affx:representedBy :gi13774942] ; affx:hasVariant [affx:representedBy :gi13774942] . :gi12831198 a affx:Transcript ; affx:unigene "iMm.160364" ; affx:translatesTo "MDSTTLVYADLNLARIQEPKHDSPPSLSPDTCRCPRWHRLALKFGCAGLILLVLVVIGLCVLVLSVQKSSVQKICADVQENRTHTTGCSAKLECPQDWLSHRDKCFHVSQVSNTWKECRIDCDKKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLSYTLTDMNWKWINGTAFNSDVLKITGVTENGSCAAISGEKVTSEGCSSDNRWICQKELNHETPCNDS" ; affx:hasCds [affx:startsAt "129737344" ; affx:stopsAt "129748416" ]; affx:hasExon [ affx:relatesToExon :Gene5005_e4; affx:cdsType "Partial" ; affx:cdsStart "129737344" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "44" ; affx:stopsAt "66" ; affx:spannedBy [ affx:startsAt "129743109" ; affx:stopsAt "129743164" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "129742493" ; affx:stopsAt "129742504" ; affx:inFrame "1" ] ; ] ; ] ; . :gi13774942 a affx:Transcript ; affx:unigene "iMm.14489" ; affx:translatesTo "MDSTTLVYADLNLARIQEPKHDSPPSLSPDTCRCPRWHRLALKFGCAGLILLVLVVIGLCVLVLSVQKSSVQKICADVQENRTHTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS" ; affx:hasCds [affx:startsAt "129703466" ; affx:stopsAt "129748416" ]; affx:hasExon [ affx:relatesToExon :Gene5005_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e10; affx:cdsType "Partial" ; affx:cdsStop "129748416" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "44" ; affx:stopsAt "66" ; affx:spannedBy [ affx:startsAt "129743109" ; affx:stopsAt "129743164" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "129742493" ; affx:stopsAt "129742504" ; affx:inFrame "1" ] ; ] ; ] ; . :gi13774942 a affx:Transcript ; affx:unigene "iMm.14489" ; affx:translatesTo "MDSTTLVYADLNLARIQEPKHDSPPSLSPDTCRCPRWHRLALKFGCAGLILLVLVVIGLCVLVLSVQKSSVQKICADVQENRTHTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS" ; affx:hasCds [affx:startsAt "129703466" ; affx:stopsAt "129748416" ]; affx:hasExon [ affx:relatesToExon :Gene5005_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5005_e10; affx:cdsType "Partial" ; affx:cdsStop "129748416" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "44" ; affx:stopsAt "66" ; affx:spannedBy [ affx:startsAt "129743109" ; affx:stopsAt "129743164" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "129742493" ; affx:stopsAt "129742504" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene5005_e1 a affx:Exon ; affx:startsAt "129703466" ; affx:stopsAt "129703608" ; affx:commonToAll "0" . :Gene5005_e2 a affx:Exon ; affx:startsAt "129706709" ; affx:stopsAt "129706825" ; affx:commonToAll "0" . :Gene5005_e3 a affx:Exon ; affx:startsAt "129707150" ; affx:stopsAt "129707305" ; affx:commonToAll "0" . :Gene5005_e4 a affx:Exon ; affx:startsAt "129737039" ; affx:stopsAt "129737486" ; affx:commonToAll "0" . :Gene5005_e5 a affx:Exon ; affx:startsAt "129740640" ; affx:stopsAt "129740756" ; affx:commonToAll "0" . :Gene5005_e6 a affx:Exon ; affx:startsAt "129741080" ; affx:stopsAt "129741235" ; affx:commonToAll "0" . :Gene5005_e7 a affx:Exon ; affx:startsAt "129742432" ; affx:stopsAt "129742504" ; affx:commonToAll "1" . :Gene5005_e8 a affx:Exon ; affx:startsAt "129743109" ; affx:stopsAt "129743208" ; affx:commonToAll "1" . :Gene5005_e9 a affx:Exon ; affx:startsAt "129748328" ; affx:stopsAt "129748416" ; affx:commonToAll "0" . :Gene5005_e10 a affx:Exon ; affx:startsAt "129748328" ; affx:stopsAt "129748422" ; affx:commonToAll "0" . :Ocil a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13958627] . :gi13958627 a affx:Transcript ; affx:unigene "iMm.197536" ; affx:translatesTo "MCVTKASLPMLSPTGSPQEVEVGKILQGKRHGTISPESCAKLYCYYGVIMVLTVAVIALSVALSATKTEQIPVNKTYAACPQNWIGVENKCFYFSEYPSNWTFAQAFCMAQEAQLARFDNQDELNFLMRYKANFDSWIGLHRESSEHPWKWTDNTEYNNTIPIRGEERFAYLNNNGISSTRIYSLRMWICSKLNSYSLHCQTPFFPS" ; affx:hasCds [affx:startsAt "130105808" ; affx:stopsAt "130111813" ]; affx:hasExon [ affx:relatesToExon :Ocil_e1; affx:cdsType "Partial" ; affx:cdsStart "130105808" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Ocil_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Ocil_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Ocil_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Ocil_e5; affx:cdsType "Partial" ; affx:cdsStop "130111670" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "42" ; affx:stopsAt "64" ; affx:spannedBy [ affx:startsAt "130108804" ; affx:stopsAt "130108870" ; affx:inFrame "0" ] ; ] ; ] ; . :Ocil_e1 a affx:Exon ; affx:startsAt "130105749" ; affx:stopsAt "130105875" ; affx:commonToAll "1" . :Ocil_e2 a affx:Exon ; affx:startsAt "130108745" ; affx:stopsAt "130108871" ; affx:commonToAll "1" . :Ocil_e3 a affx:Exon ; affx:startsAt "130109934" ; affx:stopsAt "130110113" ; affx:commonToAll "1" . :Ocil_e4 a affx:Exon ; affx:startsAt "130110577" ; affx:stopsAt "130110684" ; affx:commonToAll "1" . :Ocil_e5 a affx:Exon ; affx:startsAt "130111666" ; affx:stopsAt "130112336" ; affx:commonToAll "1" . :Dchil a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13172896] . :gi13172896 a affx:Transcript ; affx:unigene "iMm.23567" ; affx:translatesTo "MESLCGVLGFLLLAAGLPLQAAKRFRDVLGHEQYPDHMREHNQLRGWSSDENEWDEHLYPVWRRGDGRWKDSWEGGRVQAVLTSDSPALVGSNITFVVNLVFPRCQKEDANGNIVYEKNCRNDLGLTSDLHVYNWTAGADDGDWEDGTSRSQHLRFPDRRPFPRPHGWKKWSFVYVFHTLGQYFQKLGRCSARVSINTVNLTAGPQVMEVTVFRRYGRAYIPISKVKDVYVITDQIPVFVTMSQKNDRNLSDEIFLRDLPIVFDVLIHDPSHFLNDSAISYKWNFGDNTGLFVSNNHTLNHTYVLNGTFNLNLTVQTAVPGPCPPPSPSTPPPPSTPPSPPPSPLPTLSTPSPSLMPTGYKSMELSDISNENCRINRYGYFRATITIVEGILEVSIMQIADVPMPTPQPANSLMDFTVTCKGATPMEACTIISDPTCQIAQNRVCSPVAVDGLCLLSVRRAFNGSGTYCVNFTLGDDASLALTSTLISIPGKDPDSPLRAVNGVLISIGCLAVLVTMVTILLYKKHKAYKPIGNCPRNTVKGKGLSVLLSHAKAPFFRGDQEKDPLLQDKPRTL" ; affx:hasCds [affx:startsAt "49387142" ; affx:stopsAt "49406734" ]; affx:hasExon [ affx:relatesToExon :Dchil_e1; affx:cdsType "Partial" ; affx:cdsStart "49387142" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Dchil_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Dchil_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Dchil_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Dchil_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Dchil_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Dchil_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Dchil_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Dchil_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Dchil_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Dchil_e11; affx:cdsType "Partial" ; affx:cdsStop "49406734" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "22" ; affx:spannedBy [ affx:startsAt "49387142" ; affx:stopsAt "49387208" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "500" ; affx:stopsAt "522" ; affx:spannedBy [ affx:startsAt "49406063" ; affx:stopsAt "49406129" ; affx:inFrame "2" ] ; ] ; ] ; . :Dchil_e1 a affx:Exon ; affx:startsAt "49387099" ; affx:stopsAt "49387212" ; affx:commonToAll "1" . :Dchil_e2 a affx:Exon ; affx:startsAt "49393186" ; affx:stopsAt "49393339" ; affx:commonToAll "1" . :Dchil_e3 a affx:Exon ; affx:startsAt "49394416" ; affx:stopsAt "49394560" ; affx:commonToAll "1" . :Dchil_e4 a affx:Exon ; affx:startsAt "49395724" ; affx:stopsAt "49395898" ; affx:commonToAll "1" . :Dchil_e5 a affx:Exon ; affx:startsAt "49397713" ; affx:stopsAt "49397872" ; affx:commonToAll "1" . :Dchil_e6 a affx:Exon ; affx:startsAt "49398155" ; affx:stopsAt "49398521" ; affx:commonToAll "1" . :Dchil_e7 a affx:Exon ; affx:startsAt "49400829" ; affx:stopsAt "49400928" ; affx:commonToAll "1" . :Dchil_e8 a affx:Exon ; affx:startsAt "49401443" ; affx:stopsAt "49401546" ; affx:commonToAll "1" . :Dchil_e9 a affx:Exon ; affx:startsAt "49402237" ; affx:stopsAt "49402446" ; affx:commonToAll "1" . :Dchil_e10 a affx:Exon ; affx:startsAt "49406040" ; affx:stopsAt "49406134" ; affx:commonToAll "1" . :Dchil_e11 a affx:Exon ; affx:startsAt "49406580" ; affx:stopsAt "49407202" ; affx:commonToAll "1" . :Wnt16 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16716412] . :gi16716412 a affx:Transcript ; affx:unigene "iMm.137403" ; affx:translatesTo "MDRAALLALPSLCALWAAVLSLLPCGTQGNWMWLGIASFGVPEKLGCADLPLNSRQKELCKRKPYLLPSIREGARLGIQECRSQFRHERWNCMVATTTSTQLATAPLFGYELSSGTKETAFIYAIMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSPSEGWHWGGCSDDVQYGMWFSRKFLDLPIRNTTGKESRVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHFLKDKYENSIQISDKTKRKMRRREKDQRQTPILKDDLLYVHKSPNYCVENKKLGIPGTQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK" ; affx:hasCds [affx:startsAt "22236535" ; affx:stopsAt "22246260" ]; affx:hasExon [ affx:relatesToExon :Wnt16_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Wnt16_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Wnt16_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Wnt16_e4; affx:cdsType "Full" ; affx:frame "0"] ; . :Wnt16_e1 a affx:Exon ; affx:startsAt "22236535" ; affx:stopsAt "22236630" ; affx:commonToAll "1" . :Wnt16_e2 a affx:Exon ; affx:startsAt "22236809" ; affx:stopsAt "22237057" ; affx:commonToAll "1" . :Wnt16_e3 a affx:Exon ; affx:startsAt "22238946" ; affx:stopsAt "22239233" ; affx:commonToAll "1" . :Wnt16_e4 a affx:Exon ; affx:startsAt "22245795" ; affx:stopsAt "22246260" ; affx:commonToAll "1" . :Gprc5d a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16716416] . :gi16716416 a affx:Transcript ; affx:unigene "iMm.49902" ; affx:translatesTo "MYEDCVKSTEDYYLFCDNEGPWAIVLESLAVIGIVVTILLLLAFLFLMRKVQDCSQWNVLPTQFLFLLAVLGLFGLTFAFIIQLNHQTAPVRYFLFGVLFAICFSCLLAHASNLVKLVRGRVSFCWTTILFIAIGVSLLQTIIAIEYVTLIMTRGLMFEHMTPYQLNVDFVCLLIYVLFLMALTFFVSKATFCGPCENWKQHGRLIFATVLVSIIIWVVWISMLLRGNPQLQRQPHWDDAVICIGLVTNAWVFLLIYIIPELSILYRSCRQECPTQGNVCQVPVYQRSFRMDTQEPTREC" ; affx:hasCds [affx:startsAt "135446520" ; affx:stopsAt "135457173" ]; affx:hasExon [ affx:relatesToExon :Gprc5d_e1; affx:cdsType "Partial" ; affx:cdsStart "135446520" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gprc5d_e2; affx:cdsType "Partial" ; affx:cdsStop "135457173" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gprc5d_e3; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "22" ; affx:stopsAt "44" ; affx:spannedBy [ affx:startsAt "135457041" ; affx:stopsAt "135457107" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "64" ; affx:stopsAt "83" ; affx:spannedBy [ affx:startsAt "135456924" ; affx:stopsAt "135456981" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "93" ; affx:stopsAt "115" ; affx:spannedBy [ affx:startsAt "135456828" ; affx:stopsAt "135456894" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "122" ; affx:stopsAt "144" ; affx:spannedBy [ affx:startsAt "135456741" ; affx:stopsAt "135456807" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "164" ; affx:stopsAt "186" ; affx:spannedBy [ affx:startsAt "135456615" ; affx:stopsAt "135456681" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "203" ; affx:stopsAt "225" ; affx:spannedBy [ affx:startsAt "135456498" ; affx:stopsAt "135456564" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "240" ; affx:stopsAt "259" ; affx:spannedBy [ affx:startsAt "135456396" ; affx:stopsAt "135456453" ; affx:inFrame "0" ] ; ] ; ] ; . :Gprc5d_e1 a affx:Exon ; affx:startsAt "135446253" ; affx:stopsAt "135446528" ; affx:commonToAll "1" . :Gprc5d_e2 a affx:Exon ; affx:startsAt "135456278" ; affx:stopsAt "135457216" ; affx:commonToAll "1" . :Gprc5d_e3 a affx:Exon ; affx:startsAt "135458445" ; affx:stopsAt "135458549" ; affx:commonToAll "1" . :Kel a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi14211537] . :gi14211537 a affx:Transcript ; affx:unigene "iMm.19958" ; affx:translatesTo "MGPPWSQESSPEERLPTEWSRQLTRARWVLLAVLLCGLLLGSSMLWFYIFRNCGPCPCETPVCMELLDHYLASGNRSVAPCTDFFSFACEKANGTSDSFQALTEENKSRLWRLLEAPGSWHLGSGEEKAFQFYNSCMDTDAIEASGSGPLIQIIEELGGWNITGNWTSLDFNQNLRLLMSQYGHFPFFRAYLRPHPAPPHTPIIQIDQPEFDILLQQEQEQKVYAQILREYVTYLNRLGTLLGSNPQEAQQHASWSIVFTSRLFQFLRPQQQQQAQDKLFHVVTIDELQEMAPAIDWLSCLQAIFTPMSLNSSQTLVVHDLDYLRNMSQLVEEGLLNHRESIQSYMILGLVDTLSPALDTKFQEARRELIQELRKLKERPPLPAYPRWMKCVEQTGAFFEPTLAALFVREAFGPSIQSAAMELFAEIKDAVIIRLKKLSWISEETQKEALNKLAQLQVEMGAPKRAVKPDIATQEYNDIQLGPSFLQSFLSCVRSLRARNVQSFLQPFPYHRWQKSPWEVNAYYSISDHMVVFPAGLLQPPFFHPGYPRAVNFGAAGSIMAHELLHIFYQLLLPGGCPACDTHVLQEALLCLERHYAAFPLPSISSFNGSHTLLENAADIGGVAIAFQAYSKRIVEHTGELTLPNLDLSPYQLFFRSYAQVMCRGLSSQDPQDPHSPPSLRVHGPLSNTPDFAKHFHCPRGTLLNPSARCKLW" ; affx:hasCds [affx:startsAt "41878170" ; affx:stopsAt "41895681" ]; affx:hasExon [ affx:relatesToExon :Kel_e1; affx:cdsType "Partial" ; affx:cdsStart "41878170" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kel_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Kel_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kel_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Kel_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kel_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Kel_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kel_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Kel_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kel_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kel_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kel_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kel_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Kel_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Kel_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kel_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Kel_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kel_e18; affx:cdsType "Partial" ; affx:cdsStop "41895681" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Kel_e19; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "44" ; affx:spannedBy [ affx:startsAt "41895657" ; affx:stopsAt "41895681" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "41895288" ; affx:stopsAt "41895396" ; affx:inFrame "2" ] ; ] ; ] ; . :Kel_e1 a affx:Exon ; affx:startsAt "41878069" ; affx:stopsAt "41878332" ; affx:commonToAll "1" . :Kel_e2 a affx:Exon ; affx:startsAt "41879412" ; affx:stopsAt "41879508" ; affx:commonToAll "1" . :Kel_e3 a affx:Exon ; affx:startsAt "41879835" ; affx:stopsAt "41880005" ; affx:commonToAll "1" . :Kel_e4 a affx:Exon ; affx:startsAt "41880213" ; affx:stopsAt "41880281" ; affx:commonToAll "1" . :Kel_e5 a affx:Exon ; affx:startsAt "41880429" ; affx:stopsAt "41880540" ; affx:commonToAll "1" . :Kel_e6 a affx:Exon ; affx:startsAt "41880682" ; affx:stopsAt "41880783" ; affx:commonToAll "1" . :Kel_e7 a affx:Exon ; affx:startsAt "41881167" ; affx:stopsAt "41881245" ; affx:commonToAll "1" . :Kel_e8 a affx:Exon ; affx:startsAt "41881430" ; affx:stopsAt "41881529" ; affx:commonToAll "1" . :Kel_e9 a affx:Exon ; affx:startsAt "41882640" ; affx:stopsAt "41882751" ; affx:commonToAll "1" . :Kel_e10 a affx:Exon ; affx:startsAt "41889244" ; affx:stopsAt "41889374" ; affx:commonToAll "1" . :Kel_e11 a affx:Exon ; affx:startsAt "41890195" ; affx:stopsAt "41890344" ; affx:commonToAll "1" . :Kel_e12 a affx:Exon ; affx:startsAt "41890783" ; affx:stopsAt "41890972" ; affx:commonToAll "1" . :Kel_e13 a affx:Exon ; affx:startsAt "41891059" ; affx:stopsAt "41891122" ; affx:commonToAll "1" . :Kel_e14 a affx:Exon ; affx:startsAt "41893808" ; affx:stopsAt "41893955" ; affx:commonToAll "1" . :Kel_e15 a affx:Exon ; affx:startsAt "41894255" ; affx:stopsAt "41894380" ; affx:commonToAll "1" . :Kel_e16 a affx:Exon ; affx:startsAt "41894807" ; affx:stopsAt "41894984" ; affx:commonToAll "1" . :Kel_e17 a affx:Exon ; affx:startsAt "41895254" ; affx:stopsAt "41895396" ; affx:commonToAll "1" . :Kel_e18 a affx:Exon ; affx:startsAt "41895657" ; affx:stopsAt "41895769" ; affx:commonToAll "1" . :Kel_e19 a affx:Exon ; affx:startsAt "41896052" ; affx:stopsAt "41896193" ; affx:commonToAll "1" . :BC003332 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13385099] . :gi13385099 a affx:Transcript ; affx:unigene "iMm.100116" ; affx:translatesTo "MDLPAVLAAPATRGDQHGGGPSRLRRGAGPSLGAGPGRRRLLLLRGPEDGGPGPRPEEAPGPSPPPPEDGGDSFVVLLEVPRAADTHGQEEAEPDSGASPTEQVPAAAPGAALAGTVTIHNQDLLVRFDRGVFTLAAAPAPAAPSLHPATTPGLEPSSAAASRRGPVAASAGSPAYRCPEPQCALSFAKKHQLKVHLLTHGSLQGRRPFKCPLDGCGWAFTTSYKLKRHLQSHDKLRPFSCPVGGCGKKFTTVYNLKAHMKGHEQESLFKCEVCAERFPTHAKLNSHQRSHFEPERPYKCDFPGCEKTFITVSALFSHNRAHFREQELFSCSFPGCNKQYDKACRLKIHLRSHTGERPFICDSDSCGWTFTSMSKLLRHKRKHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFECPVEGCCARFSARSSLYIHSKKHLQDVGTPKSRCPVSSCNRLFTSKHSMKAHVVRQHSRRQDLVPQLEAPSSLTPSSELSSPGQSELTNIDLAALFSDTPANSSSSTAGSDEALNSGILTIDVTSVSSSLGGNLPTNNNSLGPMDPLVLVAHGDMPPSLDSPLVLGTSATVLQPGSFSADDSQAMSTGAVGCLVALPVRNLNQDSPALTPSNNLTAPGTTPTSSDTTQETGSVPDLLVPIKVEQDLSPVPDGPGAERKPWAIPICAVQLYREARGSEGLRAQCWHRQSLLGMKHSIPSPPLAHFPNALWIVLGMNPVYADGSFWCAEGQMEPGQ" ; affx:hasCds [affx:startsAt "91112225" ; affx:stopsAt "91125221" ]; affx:hasExon [ affx:relatesToExon :BC003332_e1; affx:cdsType "Partial" ; affx:cdsStart "91112225" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :BC003332_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :BC003332_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :BC003332_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :BC003332_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :BC003332_e6; affx:cdsType "Partial" ; affx:cdsStop "91124968" ; affx:frame "1"] ; . :BC003332_e1 a affx:Exon ; affx:startsAt "91112100" ; affx:stopsAt "91113135" ; affx:commonToAll "1" . :BC003332_e2 a affx:Exon ; affx:startsAt "91115108" ; affx:stopsAt "91115261" ; affx:commonToAll "1" . :BC003332_e3 a affx:Exon ; affx:startsAt "91115353" ; affx:stopsAt "91115432" ; affx:commonToAll "1" . :BC003332_e4 a affx:Exon ; affx:startsAt "91116277" ; affx:stopsAt "91116408" ; affx:commonToAll "1" . :BC003332_e5 a affx:Exon ; affx:startsAt "91121350" ; affx:stopsAt "91121521" ; affx:commonToAll "1" . :BC003332_e6 a affx:Exon ; affx:startsAt "91124398" ; affx:stopsAt "91125661" ; affx:commonToAll "1" . :slpm a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13873317] . :gi13873317 a affx:Transcript ; affx:unigene "iMm.138766" ; affx:translatesTo "MASLQMFYQPGALMHLLILCLFLETPYGQENWNNPLSLDMIVSPMKGKNEFTVTLQVKNNVGQCMVVKVSTVMNPSIKYLSAHAIYTSCLCSANKYFWDIQVSDNTALQGKAEVVPAKSICPDDEKIFPVTSYVETATQKIIVS" ; affx:hasCds [affx:startsAt "42058500" ; affx:stopsAt "42062484" ]; affx:hasExon [ affx:relatesToExon :slpm_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :slpm_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :slpm_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :slpm_e4; affx:cdsType "Full" ; affx:frame "2"] ; . :slpm_e1 a affx:Exon ; affx:startsAt "42058500" ; affx:stopsAt "42058595" ; affx:commonToAll "1" . :slpm_e2 a affx:Exon ; affx:startsAt "42060026" ; affx:stopsAt "42060129" ; affx:commonToAll "1" . :slpm_e3 a affx:Exon ; affx:startsAt "42061944" ; affx:stopsAt "42062056" ; affx:commonToAll "1" . :slpm_e4 a affx:Exon ; affx:startsAt "42062359" ; affx:stopsAt "42062484" ; affx:commonToAll "1" . :Foxp1a a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi14582795] ; affx:hasVariant [affx:representedBy :gi14582797] . :gi14582795 a affx:Transcript ; affx:unigene "iMm.197479" ; affx:translatesTo "MMQESGSETKSNGSAIQNGSSGGNHLLECGALRDTRSNGEAPAVDLGAADLAHVQQQQQQALQVARQLLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTSSNHSSLDLTSTCVSSSAPSKSSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCDDFPAFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGSLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPIHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME" ; affx:hasCds [affx:startsAt "99762244" ; affx:stopsAt "99996274" ]; affx:hasExon [ affx:relatesToExon :Foxp1a_e1; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e16; affx:cdsType "Full" ; affx:frame "2"] ; . :gi14582797 a affx:Transcript ; affx:unigene "iMm.197479" ; affx:translatesTo "MMQESGSETKSNGSAIQNGSSGGNHLLECGALRDTRSNGEAPAVDLGAADLAHVQQQQQQALQVARQLLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTSSNHSSLDLTSTCVSSSAPSKSSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCDDFPAFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKASMAENSIPLYTTASMGNPTLGSLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPIHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME" ; affx:hasCds [affx:startsAt "99762244" ; affx:stopsAt "99996274" ]; affx:hasExon [ affx:relatesToExon :Foxp1a_e1; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Foxp1a_e16; affx:cdsType "Full" ; affx:frame "2"] ; . :Foxp1a_e1 a affx:Exon ; affx:startsAt "99762244" ; affx:stopsAt "99762389" ; affx:commonToAll "1" . :Foxp1a_e2 a affx:Exon ; affx:startsAt "99767428" ; affx:stopsAt "99767595" ; affx:commonToAll "1" . :Foxp1a_e3 a affx:Exon ; affx:startsAt "99771873" ; affx:stopsAt "99771943" ; affx:commonToAll "0" . :Foxp1a_e4 a affx:Exon ; affx:startsAt "99773690" ; affx:stopsAt "99773812" ; affx:commonToAll "0" . :Foxp1a_e5 a affx:Exon ; affx:startsAt "99776773" ; affx:stopsAt "99776875" ; affx:commonToAll "1" . :Foxp1a_e6 a affx:Exon ; affx:startsAt "99777501" ; affx:stopsAt "99777581" ; affx:commonToAll "1" . :Foxp1a_e7 a affx:Exon ; affx:startsAt "99777688" ; affx:stopsAt "99777890" ; affx:commonToAll "1" . :Foxp1a_e8 a affx:Exon ; affx:startsAt "99786475" ; affx:stopsAt "99786559" ; affx:commonToAll "1" . :Foxp1a_e9 a affx:Exon ; affx:startsAt "99798306" ; affx:stopsAt "99798394" ; affx:commonToAll "1" . :Foxp1a_e10 a affx:Exon ; affx:startsAt "99810309" ; affx:stopsAt "99810414" ; affx:commonToAll "1" . :Foxp1a_e11 a affx:Exon ; affx:startsAt "99835380" ; affx:stopsAt "99835585" ; affx:commonToAll "1" . :Foxp1a_e12 a affx:Exon ; affx:startsAt "99842084" ; affx:stopsAt "99842235" ; affx:commonToAll "1" . :Foxp1a_e13 a affx:Exon ; affx:startsAt "99847613" ; affx:stopsAt "99847700" ; affx:commonToAll "1" . :Foxp1a_e14 a affx:Exon ; affx:startsAt "99848717" ; affx:stopsAt "99848855" ; affx:commonToAll "1" . :Foxp1a_e15 a affx:Exon ; affx:startsAt "99908454" ; affx:stopsAt "99908646" ; affx:commonToAll "1" . :Foxp1a_e16 a affx:Exon ; affx:startsAt "99996094" ; affx:stopsAt "99996274" ; affx:commonToAll "1" . :Gene5014 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13445783] ; affx:hasVariant [affx:representedBy :gi13445785] . :gi13445783 a affx:Transcript ; affx:unigene "iMm.86765" ; affx:translatesTo "MYGSARSVGKVEPSSQSPGRSPRLPRSPRLGHRRTNSTGGSSGNSVGGGSGKTLSMENIQSLNAAYATSGPMYLSDHENVGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTIQALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSSEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKDAQGEELKKRAAGLQSEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQEEIDTYKKDLKDLREKVSLLQGDLSEKEASLLDIKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEATLEARASPEMSDRIQQLEREISRYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDSLSDSSQQLQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSKKKTQEEVAALKREKDRLVQQLKQQTQNRMKLMADNYEDDHFRSSRSNQTNHKPSPDQDEEEGIWA" ; affx:hasCds [affx:startsAt "120417559" ; affx:stopsAt "120624184" ]; affx:hasExon [ affx:relatesToExon :Gene5014_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5014_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5014_e3; affx:cdsType "Partial" ; affx:cdsStart "120417559" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e14; affx:cdsType "Partial" ; affx:cdsStop "120560335" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e20; affx:cdsType "Partial" ; affx:cdsStop "120624184" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e21; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5014_e22; affx:cdsType "None" ] ; . :gi13445785 a affx:Transcript ; affx:unigene "iMm.86765" ; affx:translatesTo "MYGSARSVGKVEPSSQSPGRSPRLPRSPRLGHRRTNSTGGSSGNSVGGGSGKTLSMENIQSLNAAYATSGPMYLSDHENVGAETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTIQALQDELRIQRDLNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLLEQKEKENNMLREEMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSSEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKDAQGEELKKRAAGLQSEIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQEEIDTYKKDLKDLREKVSLLQGDLSEKEASLLDIKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEATLEARASPEMSDRIQQLEREISRYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDSLSDSSQQLQDSLRKKDDRIEELEEALRESVQITAEREMVLAQEESARTNAEKQVEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSKKKTQEEVAALKREKDRLVQQLKQQTQNRMKLMADNYEDDHFRSSRSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHLTALCHDRDPLILRGLTPPASYNADGEQAAWENELQKMTQEQLQNELEKVEGDNAELQEFANTILQQIADHCPDILEQVVNALEESS" ; affx:hasCds [affx:startsAt "120372889" ; affx:stopsAt "120624184" ]; affx:hasExon [ affx:relatesToExon :Gene5014_e1; affx:cdsType "Partial" ; affx:cdsStart "120372889" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e14; affx:cdsType "Partial" ; affx:cdsStop "120560335" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e20; affx:cdsType "Partial" ; affx:cdsStop "120624184" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5014_e21; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5014_e22; affx:cdsType "None" ] ; . :Gene5014_e1 a affx:Exon ; affx:startsAt "120372509" ; affx:stopsAt "120373027" ; affx:commonToAll "1" . :Gene5014_e2 a affx:Exon ; affx:startsAt "120393394" ; affx:stopsAt "120393583" ; affx:commonToAll "1" . :Gene5014_e3 a affx:Exon ; affx:startsAt "120417519" ; affx:stopsAt "120417586" ; affx:commonToAll "0" . :Gene5014_e4 a affx:Exon ; affx:startsAt "120418984" ; affx:stopsAt "120419083" ; affx:commonToAll "1" . :Gene5014_e5 a affx:Exon ; affx:startsAt "120429276" ; affx:stopsAt "120429421" ; affx:commonToAll "1" . :Gene5014_e6 a affx:Exon ; affx:startsAt "120493511" ; affx:stopsAt "120493672" ; affx:commonToAll "1" . :Gene5014_e7 a affx:Exon ; affx:startsAt "120512621" ; affx:stopsAt "120512753" ; affx:commonToAll "0" . :Gene5014_e8 a affx:Exon ; affx:startsAt "120521291" ; affx:stopsAt "120521427" ; affx:commonToAll "1" . :Gene5014_e9 a affx:Exon ; affx:startsAt "120533199" ; affx:stopsAt "120533211" ; affx:commonToAll "1" . :Gene5014_e10 a affx:Exon ; affx:startsAt "120542407" ; affx:stopsAt "120542601" ; affx:commonToAll "1" . :Gene5014_e11 a affx:Exon ; affx:startsAt "120548957" ; affx:stopsAt "120549098" ; affx:commonToAll "1" . :Gene5014_e12 a affx:Exon ; affx:startsAt "120550319" ; affx:stopsAt "120550460" ; affx:commonToAll "1" . :Gene5014_e13 a affx:Exon ; affx:startsAt "120552378" ; affx:stopsAt "120552516" ; affx:commonToAll "1" . :Gene5014_e14 a affx:Exon ; affx:startsAt "120560263" ; affx:stopsAt "120560433" ; affx:commonToAll "1" . :Gene5014_e15 a affx:Exon ; affx:startsAt "120572972" ; affx:stopsAt "120573140" ; affx:commonToAll "1" . :Gene5014_e16 a affx:Exon ; affx:startsAt "120577226" ; affx:stopsAt "120577310" ; affx:commonToAll "1" . :Gene5014_e17 a affx:Exon ; affx:startsAt "120578715" ; affx:stopsAt "120578871" ; affx:commonToAll "1" . :Gene5014_e18 a affx:Exon ; affx:startsAt "120582627" ; affx:stopsAt "120582702" ; affx:commonToAll "1" . :Gene5014_e19 a affx:Exon ; affx:startsAt "120596145" ; affx:stopsAt "120596562" ; affx:commonToAll "1" . :Gene5014_e20 a affx:Exon ; affx:startsAt "120623515" ; affx:stopsAt "120624339" ; affx:commonToAll "1" . :Gene5014_e21 a affx:Exon ; affx:startsAt "120624810" ; affx:stopsAt "120624949" ; affx:commonToAll "1" . :Gene5014_e22 a affx:Exon ; affx:startsAt "120647532" ; affx:stopsAt "120647790" ; affx:commonToAll "1" . :oatp2 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi10119770] . :gi10119770 a affx:Transcript ; affx:unigene "iMm.101645" ; affx:translatesTo "MGKSEKEVATHGVRCFSKIKAFLLALTCAYVSKSLSGTYMNSMLTQIERQFGIPTSVVGLINGSFEIGNLLLIIFVSYFGTKLHRPIMIGVGCAVMGLGCFLISIPHFLMGRYEYETTILPTSNLSSNSFVCTENRTQTLKPTQDPTECVKEMKSLMWIYVLVGNIIRGMGETPIMPLGISYIEDFAKSENSPLYIGILETGMTIGPLIGLLLGSSCANIYVDTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLLKEGLQDNGDGTENAKEEKHREKIKEENRGITKDFFLFMKSLSCNPIYMIFILISVIQVNAFINSFTFMPKYLEQQYGKSTAEIVFLMGLYMLPPICLGYLIGGLIMKKFKITVKKAAYIGFWLSLTEYLLSFVSYIMTCDNFPVAGLTTSYEGVQHPLYVENNVLADCNTKCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGTGTNMVFQNCSCIQSSGNASAVLGLCDKGPECANKLQYFLIISIIGCFIFSLGAIPGYMVLLRCMKSEEKSLGVGLHTFCMRILGGIPAPIYFGALIDRTCLHWGTLKCGEPGACRMYDINSFRRIYLGLPAALRGASFLPALFILILMRKFQFPGDIDSSDTDPAEMKLTAKESKCTNVHRSPTMQNDGERKTKL" ; affx:hasCds [affx:startsAt "142389573" ; affx:stopsAt "142428429" ]; affx:hasExon [ affx:relatesToExon :oatp2_e1; affx:cdsType "Partial" ; affx:cdsStart "142389573" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oatp2_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oatp2_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oatp2_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oatp2_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oatp2_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oatp2_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oatp2_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oatp2_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oatp2_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oatp2_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oatp2_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oatp2_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oatp2_e14; affx:cdsType "Partial" ; affx:cdsStop "142428429" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oatp2_e15; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :oatp2_e16; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :oatp2_e17; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "11" ; affx:containsMotif [ affx:startsAt "21" ; affx:stopsAt "43" ; affx:spannedBy [ affx:startsAt "142424146" ; affx:stopsAt "142424212" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "58" ; affx:stopsAt "80" ; affx:spannedBy [ affx:startsAt "142424073" ; affx:stopsAt "142424101" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "142422438" ; affx:stopsAt "142422476" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "87" ; affx:stopsAt "109" ; affx:spannedBy [ affx:startsAt "142422351" ; affx:stopsAt "142422417" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "158" ; affx:stopsAt "180" ; affx:spannedBy [ affx:startsAt "142413568" ; affx:stopsAt "142413634" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "193" ; affx:stopsAt "215" ; affx:spannedBy [ affx:startsAt "142413519" ; affx:stopsAt "142413529" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "142409100" ; affx:stopsAt "142409156" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "244" ; affx:stopsAt "266" ; affx:spannedBy [ affx:startsAt "142407906" ; affx:stopsAt "142407972" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "317" ; affx:stopsAt "339" ; affx:spannedBy [ affx:startsAt "142402313" ; affx:stopsAt "142402379" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "354" ; affx:stopsAt "376" ; affx:spannedBy [ affx:startsAt "142402255" ; affx:stopsAt "142402268" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "142400676" ; affx:stopsAt "142400729" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "512" ; affx:stopsAt "534" ; affx:spannedBy [ affx:startsAt "142395294" ; affx:stopsAt "142395360" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "549" ; affx:stopsAt "571" ; affx:spannedBy [ affx:startsAt "142393062" ; affx:stopsAt "142393090" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "142391974" ; affx:stopsAt "142392012" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "600" ; affx:stopsAt "622" ; affx:spannedBy [ affx:startsAt "142389720" ; affx:stopsAt "142389786" ; affx:inFrame "1" ] ; ] ; ] ; . :oatp2_e1 a affx:Exon ; affx:startsAt "142388052" ; affx:stopsAt "142389793" ; affx:commonToAll "1" . :oatp2_e2 a affx:Exon ; affx:startsAt "142391894" ; affx:stopsAt "142392012" ; affx:commonToAll "1" . :oatp2_e3 a affx:Exon ; affx:startsAt "142393062" ; affx:stopsAt "142393127" ; affx:commonToAll "1" . :oatp2_e4 a affx:Exon ; affx:startsAt "142395286" ; affx:stopsAt "142395459" ; affx:commonToAll "1" . :oatp2_e5 a affx:Exon ; affx:startsAt "142398123" ; affx:stopsAt "142398289" ; affx:commonToAll "1" . :oatp2_e6 a affx:Exon ; affx:startsAt "142400533" ; affx:stopsAt "142400729" ; affx:commonToAll "1" . :oatp2_e7 a affx:Exon ; affx:startsAt "142402255" ; affx:stopsAt "142402420" ; affx:commonToAll "1" . :oatp2_e8 a affx:Exon ; affx:startsAt "142407794" ; affx:stopsAt "142408016" ; affx:commonToAll "1" . :oatp2_e9 a affx:Exon ; affx:startsAt "142409057" ; affx:stopsAt "142409156" ; affx:commonToAll "1" . :oatp2_e10 a affx:Exon ; affx:startsAt "142413519" ; affx:stopsAt "142413666" ; affx:commonToAll "1" . :oatp2_e11 a affx:Exon ; affx:startsAt "142417436" ; affx:stopsAt "142417543" ; affx:commonToAll "1" . :oatp2_e12 a affx:Exon ; affx:startsAt "142422343" ; affx:stopsAt "142422476" ; affx:commonToAll "1" . :oatp2_e13 a affx:Exon ; affx:startsAt "142424073" ; affx:stopsAt "142424215" ; affx:commonToAll "1" . :oatp2_e14 a affx:Exon ; affx:startsAt "142428369" ; affx:stopsAt "142428479" ; affx:commonToAll "1" . :oatp2_e15 a affx:Exon ; affx:startsAt "142435165" ; affx:stopsAt "142435279" ; affx:commonToAll "1" . :oatp2_e16 a affx:Exon ; affx:startsAt "142438173" ; affx:stopsAt "142438250" ; affx:commonToAll "1" . :oatp2_e17 a affx:Exon ; affx:startsAt "142439084" ; affx:stopsAt "142439132" ; affx:commonToAll "1" . :Bop a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi1809321] ; affx:hasVariant [affx:representedBy :gi5870831] ; affx:hasVariant [affx:representedBy :gi5870833] . :gi1809321 a affx:Transcript ; affx:unigene "iMm.89727" ; affx:translatesTo "MKNGEACGGWQSLINFVCHTCFKRQEKLHRCGQCKFAHYCDRTCQKDAWLNHKNECAAIKKYGKVPNENIRLAARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKELRVDVDTFLQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALGKISEGEELTVSYIDFLHLSEERRRQLKKQYYFDCSCEHCQKGLKDDLFLAAKEDPKPSQEVVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNLYVLRLLSIASEVLSYLQAYEEASHYARRMVDGYMKLYHHNNAQLGMAVMRAGLTNWHAGHIEVGHGMICKAYAILLVTHGPSHPITKDLEAMRMQTEMELRMFRQNEFMYHKMREAALNNQPMQVMAEPSNEPAPALFHKKQ" ; affx:hasCds [affx:startsAt "72080536" ; affx:stopsAt "72196780" ]; affx:hasExon [ affx:relatesToExon :Bop_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Bop_e3; affx:cdsType "Partial" ; affx:cdsStart "72080536" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Bop_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Bop_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bop_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e13; affx:cdsType "Partial" ; affx:cdsStop "72196780" ; affx:frame "1"] ; . :gi5870831 a affx:Transcript ; affx:unigene "iMm.89727" ; affx:translatesTo "MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTCFKRQEKLHRCGQCKFAHYCDRTCQKDAWLNHKNECAAIKKYGKVPNENIRLAARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKELRVDVDTFLQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALGKISEGEELTVSYIDFLHLSEERRRQLKKQYYFDCSCEHCQKGLKDDLFLAAKEDPKPSQEVVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNLYVLRLLSIASEVLSYLQAYEEASHYARRMVDGYMKLYHHNNAQLGMAVMRAGLTNWHAGHIEVGHGMICKAYAILLVTHGPSHPITKDLEAMRMQTEMELRMFRQNEFMYHKMREAALNNQPMQVMAEPSNEPAPALFHKKQ" ; affx:hasCds [affx:startsAt "72080536" ; affx:stopsAt "72126641" ]; affx:hasExon [ affx:relatesToExon :Bop_e2; affx:cdsType "Partial" ; affx:cdsStart "72080536" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Bop_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Bop_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bop_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e12; affx:cdsType "Partial" ; affx:cdsStop "72126641" ; affx:frame "1"] ; . :gi5870833 a affx:Transcript ; affx:unigene "iMm.89727" ; affx:translatesTo "MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTCFKRQEKLHRCGQCKFAHYCDRTCQKDAWLNHKNECAAIKKYGKVPNENIRLAARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKELRVDVDTFLQYWPPQSQQFSMQYISHIFGVINCNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGKIELRALGKISEGEELTVSYIDFLHLSEERRRQLKKQYYFDCSCEHCQKGLKDDLFLAAKEDPKPSQEVVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNLYVLRLLSIASEVLSYLQAYEEASHYARRMVDGYMKLYHHNNAQLGMAVMRAGLTNWHAGHIEVGHGMICKAYAILLVTHGPSHPITKDLEAMRMQTEMELRMFRQNEFMYHKMREAALNNQPMQVMAEPSNEPAPALFHKKQ" ; affx:hasCds [affx:startsAt "72080536" ; affx:stopsAt "72126641" ]; affx:hasExon [ affx:relatesToExon :Bop_e2; affx:cdsType "Partial" ; affx:cdsStart "72080536" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bop_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bop_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bop_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bop_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bop_e12; affx:cdsType "Partial" ; affx:cdsStop "72126641" ; affx:frame "1"] ; . :Bop_e1 a affx:Exon ; affx:startsAt "72078730" ; affx:stopsAt "72079273" ; affx:commonToAll "0" . :Bop_e2 a affx:Exon ; affx:startsAt "72079963" ; affx:stopsAt "72080695" ; affx:commonToAll "0" . :Bop_e3 a affx:Exon ; affx:startsAt "72080128" ; affx:stopsAt "72080695" ; affx:commonToAll "0" . :Bop_e4 a affx:Exon ; affx:startsAt "72081513" ; affx:stopsAt "72081682" ; affx:commonToAll "1" . :Bop_e5 a affx:Exon ; affx:startsAt "72083644" ; affx:stopsAt "72083808" ; affx:commonToAll "1" . :Bop_e6 a affx:Exon ; affx:startsAt "72085314" ; affx:stopsAt "72085407" ; affx:commonToAll "1" . :Bop_e7 a affx:Exon ; affx:startsAt "72089781" ; affx:stopsAt "72089971" ; affx:commonToAll "1" . :Bop_e8 a affx:Exon ; affx:startsAt "72099793" ; affx:stopsAt "72099832" ; affx:commonToAll "0" . :Bop_e9 a affx:Exon ; affx:startsAt "72101807" ; affx:stopsAt "72101938" ; affx:commonToAll "1" . :Bop_e10 a affx:Exon ; affx:startsAt "72102998" ; affx:stopsAt "72103212" ; affx:commonToAll "1" . :Bop_e11 a affx:Exon ; affx:startsAt "72104000" ; affx:stopsAt "72104177" ; affx:commonToAll "1" . :Bop_e12 a affx:Exon ; affx:startsAt "72126519" ; affx:stopsAt "72126705" ; affx:commonToAll "0" . :Bop_e13 a affx:Exon ; affx:startsAt "72196745" ; affx:stopsAt "72197064" ; affx:commonToAll "0" . :Bmp10 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi6857762] . :gi6857762 a affx:Transcript ; affx:unigene "iMm.57171" ; affx:translatesTo "MGSLVLPLSAVFCLVAHSASGSPIMGLEQSPLEEDMPFFDDIFTEQDGIDFNTLLQSMKNEFLKTLNLSDIPVQDTGRVDPPEYMLELYNKFATDRTSMPSANIIRSFKNELFSQPVTFNGLRKYPLLFNVSIPHHEEVVMAELRLYTLVQRDRMMYDGVDRKITIFEVLESADGSEEERSMLVLVSTEIYGTNSEWETFDVTDATRRWQKSGPSTHQLEIHIESRQNQAEDTGRGQLEIDMSAQNKHDPLLVVFSDDQSNDKEQKEELNELITHEQDLDLDSDAFFSGPDEEALLQMRSNMIDDSSARIRRNAKGNYCKKTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLDPISILYLDKGVVTYKFKYEGMAVSECGCR" ; affx:hasCds [affx:startsAt "88285096" ; affx:stopsAt "88290557" ]; affx:hasExon [ affx:relatesToExon :Bmp10_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bmp10_e2; affx:cdsType "Full" ; affx:frame "1"] ; . :Bmp10_e1 a affx:Exon ; affx:startsAt "88285096" ; affx:stopsAt "88285429" ; affx:commonToAll "1" . :Bmp10_e2 a affx:Exon ; affx:startsAt "88289627" ; affx:stopsAt "88290557" ; affx:commonToAll "1" . :Adcyap1r1 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi6680647] . :gi6680647 a affx:Transcript ; affx:unigene "iMm.44245" ; affx:translatesTo "MARTLQLSLTALLLLPMAIAMHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEVFRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYEPESGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTMDFKHRHPSLASSGVNGGTQLSILSKSSSQLRMSSLPADNLAT" ; affx:hasCds [affx:startsAt "55865279" ; affx:stopsAt "55902213" ]; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e2; affx:cdsType "Partial" ; affx:cdsStart "55865279" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Adcyap1r1_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "20" ; affx:spannedBy [ affx:startsAt "55865279" ; affx:stopsAt "55865330" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "55866552" ; affx:stopsAt "55866561" ; affx:inFrame "1" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "156" ; affx:stopsAt "178" ; affx:spannedBy [ affx:startsAt "55883750" ; affx:stopsAt "55883816" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "191" ; affx:stopsAt "210" ; affx:spannedBy [ affx:startsAt "55884243" ; affx:stopsAt "55884300" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "230" ; affx:stopsAt "252" ; affx:spannedBy [ affx:startsAt "55885017" ; affx:stopsAt "55885083" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "265" ; affx:stopsAt "287" ; affx:spannedBy [ affx:startsAt "55885122" ; affx:stopsAt "55885150" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "55885465" ; affx:stopsAt "55885503" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "313" ; affx:stopsAt "332" ; affx:spannedBy [ affx:startsAt "55886196" ; affx:stopsAt "55886211" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "55889983" ; affx:stopsAt "55890025" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "377" ; affx:stopsAt "399" ; affx:spannedBy [ affx:startsAt "55899120" ; affx:stopsAt "55899186" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "409" ; affx:stopsAt "431" ; affx:spannedBy [ affx:startsAt "55899216" ; affx:stopsAt "55899249" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "55900615" ; affx:stopsAt "55900648" ; affx:inFrame "2" ] ; ] ; ] ; . :Adcyap1r1_e1 a affx:Exon ; affx:startsAt "55857338" ; affx:stopsAt "55857412" ; affx:commonToAll "1" . :Adcyap1r1_e2 a affx:Exon ; affx:startsAt "55865200" ; affx:stopsAt "55865330" ; affx:commonToAll "1" . :Adcyap1r1_e3 a affx:Exon ; affx:startsAt "55866552" ; affx:stopsAt "55866658" ; affx:commonToAll "1" . :Adcyap1r1_e4 a affx:Exon ; affx:startsAt "55877261" ; affx:stopsAt "55877369" ; affx:commonToAll "1" . :Adcyap1r1_e5 a affx:Exon ; affx:startsAt "55879601" ; affx:stopsAt "55879622" ; affx:commonToAll "1" . :Adcyap1r1_e6 a affx:Exon ; affx:startsAt "55880508" ; affx:stopsAt "55880550" ; affx:commonToAll "1" . :Adcyap1r1_e7 a affx:Exon ; affx:startsAt "55883123" ; affx:stopsAt "55883233" ; affx:commonToAll "1" . :Adcyap1r1_e8 a affx:Exon ; affx:startsAt "55883720" ; affx:stopsAt "55883818" ; affx:commonToAll "1" . :Adcyap1r1_e9 a affx:Exon ; affx:startsAt "55884206" ; affx:stopsAt "55884339" ; affx:commonToAll "1" . :Adcyap1r1_e10 a affx:Exon ; affx:startsAt "55884996" ; affx:stopsAt "55885150" ; affx:commonToAll "1" . :Adcyap1r1_e11 a affx:Exon ; affx:startsAt "55885465" ; affx:stopsAt "55885526" ; affx:commonToAll "1" . :Adcyap1r1_e12 a affx:Exon ; affx:startsAt "55886141" ; affx:stopsAt "55886211" ; affx:commonToAll "1" . :Adcyap1r1_e13 a affx:Exon ; affx:startsAt "55889983" ; affx:stopsAt "55890075" ; affx:commonToAll "1" . :Adcyap1r1_e14 a affx:Exon ; affx:startsAt "55896269" ; affx:stopsAt "55896353" ; affx:commonToAll "1" . :Adcyap1r1_e15 a affx:Exon ; affx:startsAt "55899119" ; affx:stopsAt "55899249" ; affx:commonToAll "1" . :Adcyap1r1_e16 a affx:Exon ; affx:startsAt "55900615" ; affx:stopsAt "55900657" ; affx:commonToAll "1" . :Adcyap1r1_e17 a affx:Exon ; affx:startsAt "55902024" ; affx:stopsAt "55902213" ; affx:commonToAll "1" . :Gene5019 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi13435441] . :gi13435441 a affx:Transcript ; affx:unigene "iMm.22706" ; affx:translatesTo "MSKHKLIILRHGEGQWNKENRFCSWVDQKLNNDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEEQVRLWRRSYNVTPPPIEESHPYFHEIYSDRRYKVCDVPLDQLPRSESLKDVLERLLPYWKERIAPEILKGKSILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGNQEAIQAAIKKVDDQGKVKQGKQ" ; affx:hasCds [affx:startsAt "34663790" ; affx:stopsAt "34680951" ]; affx:hasExon [ affx:relatesToExon :Gene5019_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5019_e2; affx:cdsType "Partial" ; affx:cdsStart "34663790" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5019_e3; affx:cdsType "Partial" ; affx:cdsStop "34680951" ; affx:frame "0"] ; . :Gene5019_e1 a affx:Exon ; affx:startsAt "34652771" ; affx:stopsAt "34652863" ; affx:commonToAll "1" . :Gene5019_e2 a affx:Exon ; affx:startsAt "34663730" ; affx:stopsAt "34664391" ; affx:commonToAll "1" . :Gene5019_e3 a affx:Exon ; affx:startsAt "34680772" ; affx:stopsAt "34681624" ; affx:commonToAll "1" . :Gene5020 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi2282605] . :gi2282605 a affx:Transcript ; affx:unigene "iMm.2436" ; affx:translatesTo "MERIPSAQPPPTCLPKAPGLEHGDLSGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGDLSGRNLEAGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGASRKPLDSAPKAVDLKEKPSFLAKGSEGPGKNCVPVIQRTFAPSGGEQSGSDTDTDSGYGGELEKGDLRSEQPYFKSDHGRRFAVGERVSTIKQESEEPPTKKSRMQLSEEEGHFAGSDLMGSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNTSAAALSSFMNPDKIPTPLLLPQRLPSPLAHSSLDSSALLQALKQIPPLNLETKD" ; affx:hasCds [affx:startsAt "109501234" ; affx:stopsAt "109505654" ]; affx:hasExon [ affx:relatesToExon :Gene5020_e1; affx:cdsType "Partial" ; affx:cdsStart "109501234" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5020_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5020_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5020_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5020_e5; affx:cdsType "Partial" ; affx:cdsStop "109505654" ; affx:frame "0"] ; . :Gene5020_e1 a affx:Exon ; affx:startsAt "109501018" ; affx:stopsAt "109501314" ; affx:commonToAll "1" . :Gene5020_e2 a affx:Exon ; affx:startsAt "109501482" ; affx:stopsAt "109501552" ; affx:commonToAll "1" . :Gene5020_e3 a affx:Exon ; affx:startsAt "109501826" ; affx:stopsAt "109501934" ; affx:commonToAll "1" . :Gene5020_e4 a affx:Exon ; affx:startsAt "109502842" ; affx:stopsAt "109502966" ; affx:commonToAll "1" . :Gene5020_e5 a affx:Exon ; affx:startsAt "109504800" ; affx:stopsAt "109507096" ; affx:commonToAll "1" . :Bv8 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi6524948] ; affx:hasVariant [affx:representedBy :gi6524950] ; affx:hasVariant [affx:representedBy :gi7656931] . :gi6524948 a affx:Transcript ; affx:unigene "iMm.87365" ; affx:translatesTo "MGDPRCAPLLLLLLLPLLFTPPAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKVSVCTGILGVPSH" ; affx:hasCds [affx:startsAt "100557186" ; affx:stopsAt "100561040" ]; affx:hasExon [ affx:relatesToExon :Bv8_e5; affx:cdsType "Partial" ; affx:cdsStart "100557186" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bv8_e7; affx:cdsType "Partial" ; affx:cdsStop "100561040" ; affx:frame "2"] ; . :gi6524950 a affx:Transcript ; affx:unigene "iMm.87365" ; affx:translatesTo "MGDPRCAPLLLLLLLPLLFTPPAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK" ; affx:hasCds [affx:startsAt "100547011" ; affx:stopsAt "100561040" ]; affx:hasExon [ affx:relatesToExon :Bv8_e1; affx:cdsType "Partial" ; affx:cdsStart "100547011" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bv8_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bv8_e7; affx:cdsType "Partial" ; affx:cdsStop "100561040" ; affx:frame "2"] ; . :gi7656931 a affx:Transcript ; affx:unigene "iMm.87365" ; affx:translatesTo "MGDPRCAPLLLLLLLPLLFTPPAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKMEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK" ; affx:hasCds [affx:startsAt "100547011" ; affx:stopsAt "100561040" ]; affx:hasExon [ affx:relatesToExon :Bv8_e2; affx:cdsType "Partial" ; affx:cdsStart "100547011" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bv8_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bv8_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Bv8_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bv8_e7; affx:cdsType "Partial" ; affx:cdsStop "100561040" ; affx:frame "2"] ; . :Bv8_e1 a affx:Exon ; affx:startsAt "100545957" ; affx:stopsAt "100547116" ; affx:commonToAll "0" . :Bv8_e2 a affx:Exon ; affx:startsAt "100545957" ; affx:stopsAt "100547117" ; affx:commonToAll "0" . :Bv8_e3 a affx:Exon ; affx:startsAt "100547268" ; affx:stopsAt "100547277" ; affx:commonToAll "0" . :Bv8_e4 a affx:Exon ; affx:startsAt "100549148" ; affx:stopsAt "100549201" ; affx:commonToAll "0" . :Bv8_e5 a affx:Exon ; affx:startsAt "100556824" ; affx:stopsAt "100557354" ; affx:commonToAll "0" . :Bv8_e6 a affx:Exon ; affx:startsAt "100557228" ; affx:stopsAt "100557354" ; affx:commonToAll "0" . :Bv8_e7 a affx:Exon ; affx:startsAt "100560947" ; affx:stopsAt "100561112" ; affx:commonToAll "1" . :Akr1b7 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi6753147] . :gi6753147 a affx:Transcript ; affx:unigene "iMm.14460" ; affx:translatesTo "MATFVELSTKAKMPLVGLGTWKSSPGQVKEAVKAAIDAGYRHIDCAYVYHNENEVGEAIQEKIKENAVKREDLFIVSKLWATFFEKSLVKKAFQNTLSDLKLDYLDLYLVHWPQGFQAGNALLPKDNKGKVLLSKSTFLDAWEAMEELVDQGLVKALGISNFNHFQIERLLNKPGLKHKPVTNQIESHPYLTQEKLIQYCQSKGIAVTAYSPLGSPDRPYAKPEDPVVMEIPKIKEIAAKHKKTVAQVLIRFHVQRNVVVIPKSVTPSRIQENLQVFDFQLSEEDMAAILSFNRNWRACDLLDARTEEDYPFHEEY" ; affx:hasCds [affx:startsAt "34586740" ; affx:stopsAt "34597219" ]; affx:hasExon [ affx:relatesToExon :Akr1b7_e1; affx:cdsType "Partial" ; affx:cdsStart "34586740" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Akr1b7_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Akr1b7_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Akr1b7_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Akr1b7_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Akr1b7_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Akr1b7_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Akr1b7_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Akr1b7_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Akr1b7_e10; affx:cdsType "Partial" ; affx:cdsStop "34597219" ; affx:frame "1"] ; . :Akr1b7_e1 a affx:Exon ; affx:startsAt "34586720" ; affx:stopsAt "34586806" ; affx:commonToAll "1" . :Akr1b7_e2 a affx:Exon ; affx:startsAt "34589650" ; affx:stopsAt "34589818" ; affx:commonToAll "1" . :Akr1b7_e3 a affx:Exon ; affx:startsAt "34590448" ; affx:stopsAt "34590565" ; affx:commonToAll "1" . :Akr1b7_e4 a affx:Exon ; affx:startsAt "34591613" ; affx:stopsAt "34591691" ; affx:commonToAll "1" . :Akr1b7_e5 a affx:Exon ; affx:startsAt "34593324" ; affx:stopsAt "34593447" ; affx:commonToAll "1" . :Akr1b7_e6 a affx:Exon ; affx:startsAt "34593738" ; affx:stopsAt "34593845" ; affx:commonToAll "1" . :Akr1b7_e7 a affx:Exon ; affx:startsAt "34594249" ; affx:stopsAt "34594331" ; affx:commonToAll "1" . :Akr1b7_e8 a affx:Exon ; affx:startsAt "34594776" ; affx:stopsAt "34594860" ; affx:commonToAll "1" . :Akr1b7_e9 a affx:Exon ; affx:startsAt "34595393" ; affx:stopsAt "34595476" ; affx:commonToAll "1" . :Akr1b7_e10 a affx:Exon ; affx:startsAt "34597176" ; affx:stopsAt "34597473" ; affx:commonToAll "1" . :AB041549 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi10946803] . :gi10946803 a affx:Transcript ; affx:unigene "iMm.142812" ; affx:translatesTo "MRPAFAVGLVFAGCCSNVIFLELLARTHPGCGNIVTFAQFLFIAVEGFLFEANLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSMFKYTSIALVSAGIFICTFMSAKQVTVQTGLSDKDGFQAFAWWLLGIAALTFALLMSARMGIFQETLYRQFGKHSKEALFYNHALPLPGFIFLASDIYDHVVLFNKSELYQVPVIGVTMPVMWFYLLMNVVTQYVCIRGVFILTTECTSLTVTLVVTLRKFVSLIFSILYFQNQFTMWHWLGTSFVFIGTLMYTEVWKNLGTTKSELQKDDKKD" ; affx:hasCds [affx:startsAt "34330730" ; affx:stopsAt "34349205" ]; affx:hasExon [ affx:relatesToExon :AB041549_e1; affx:cdsType "Partial" ; affx:cdsStart "34330730" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :AB041549_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :AB041549_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :AB041549_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :AB041549_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :AB041549_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :AB041549_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :AB041549_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :AB041549_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :AB041549_e10; affx:cdsType "Partial" ; affx:cdsStop "34349205" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "55" ; affx:spannedBy [ affx:startsAt "34349128" ; affx:stopsAt "34349205" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "34342837" ; affx:stopsAt "34342925" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "62" ; affx:stopsAt "84" ; affx:spannedBy [ affx:startsAt "34342811" ; affx:stopsAt "34342816" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "34340017" ; affx:stopsAt "34340078" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "94" ; affx:stopsAt "112" ; affx:spannedBy [ affx:startsAt "34339975" ; affx:stopsAt "34339987" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "34338732" ; affx:stopsAt "34338774" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "156" ; affx:stopsAt "175" ; affx:spannedBy [ affx:startsAt "34335679" ; affx:stopsAt "34335698" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "34334098" ; affx:stopsAt "34334136" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "196" ; affx:stopsAt "215" ; affx:spannedBy [ affx:startsAt "34334026" ; affx:stopsAt "34334035" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "34332851" ; affx:stopsAt "34332899" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "225" ; affx:stopsAt "244" ; affx:spannedBy [ affx:startsAt "34331800" ; affx:stopsAt "34331857" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "251" ; affx:stopsAt "273" ; affx:spannedBy [ affx:startsAt "34330907" ; affx:stopsAt "34330973" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "293" ; affx:stopsAt "314" ; affx:spannedBy [ affx:startsAt "34330784" ; affx:stopsAt "34330847" ; affx:inFrame "2" ] ; ] ; ] ; . :AB041549_e1 a affx:Exon ; affx:startsAt "34328229" ; affx:stopsAt "34330977" ; affx:commonToAll "1" . :AB041549_e2 a affx:Exon ; affx:startsAt "34331783" ; affx:stopsAt "34331859" ; affx:commonToAll "1" . :AB041549_e3 a affx:Exon ; affx:startsAt "34332823" ; affx:stopsAt "34332899" ; affx:commonToAll "1" . :AB041549_e4 a affx:Exon ; affx:startsAt "34334026" ; affx:stopsAt "34334136" ; affx:commonToAll "1" . :AB041549_e5 a affx:Exon ; affx:startsAt "34335679" ; affx:stopsAt "34335740" ; affx:commonToAll "1" . :AB041549_e6 a affx:Exon ; affx:startsAt "34335939" ; affx:stopsAt "34336021" ; affx:commonToAll "1" . :AB041549_e7 a affx:Exon ; affx:startsAt "34338724" ; affx:stopsAt "34338774" ; affx:commonToAll "1" . :AB041549_e8 a affx:Exon ; affx:startsAt "34339975" ; affx:stopsAt "34340078" ; affx:commonToAll "1" . :AB041549_e9 a affx:Exon ; affx:startsAt "34342811" ; affx:stopsAt "34342925" ; affx:commonToAll "1" . :AB041549_e10 a affx:Exon ; affx:startsAt "34349128" ; affx:stopsAt "34349405" ; affx:commonToAll "1" . :ADD2 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi6693690] ; affx:hasVariant [affx:representedBy :gi6851283] ; affx:hasVariant [affx:representedBy :gi7304862] . :gi6693690 a affx:Transcript ; affx:unigene "iMm.104155" ; affx:translatesTo "MSEDTVPEAASPPPSQGQHYFDRFSEDDPEYLRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHAVFPASSMNFSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFSLHSAIYAARPDVRCAIHLHTPATAAVSAMKCGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGMVALGDTVEEAFYKVFHLQAACEVQVSALSSAGGTENLILLEQEKHRPHEVGSVQWAGSTFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGVPVPALRQHAQKQQKEKTRWLNTPNTYLRVNVADEVQRNMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYTDPQEVLDMRNKIREQNRQDIKSAGPQSQLLASVIAEKSRSPVQQRLPPTEGEVYQTPGAGQGTPESSGPLTP" ; affx:hasCds [affx:startsAt "86938736" ; affx:stopsAt "86960957" ]; affx:hasExon [ affx:relatesToExon :ADD2_e1; affx:cdsType "Partial" ; affx:cdsStart "86938736" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :ADD2_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :ADD2_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e13; affx:cdsType "Partial" ; affx:cdsStop "86960957" ; affx:frame "1"] ; . :gi6851283 a affx:Transcript ; affx:unigene "iMm.104155" ; affx:translatesTo "MSEDTVPEAASPPPSQGQHYFDRFSEDDPEYLRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHAVFPASSMNFSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFSLHSAIYAARPDVRCAIHLHTPATAAVSAMKCGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKSTESQLMSKGDADTKDESEETVPNPFSQLTDQELEEYKKEVERKKLEQEQEGEKDIATEKPGSPVKSTPASPVQSPSKAGTKSPAVSPSKTSEDTKKTEVSEANTEPEPVKPEGLVVNGKEEEPSVEEALSKGLGQMTTNADTDGDSYKDKTESVTSGPLSPEGSPSKSPSKKKKKFRTPSFLKKSKKKEKVES" ; affx:hasCds [affx:startsAt "86938736" ; affx:stopsAt "86971755" ]; affx:hasExon [ affx:relatesToExon :ADD2_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :ADD2_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e16; affx:cdsType "Partial" ; affx:cdsStop "86971755" ; affx:frame "1"] ; . :gi7304862 a affx:Transcript ; affx:unigene "iMm.104155" ; affx:translatesTo "MSEDTVPEAASPPPSQGQHYFDRFSEDDPEYLRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHAVFPASSMNFSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFSLHSAIYAARPDVRCAIHLHTPATAAVSAMKCGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGMVALGDTVEEAFYKVFHLQAACEVQVSALSSAGGTENLILLEQEKHRPHEVGSVQWAGSTFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGVPVPALRQHAQKQQKEKTRWLNTPNTYLRVNVADEVQRNMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYTDPQEVLDMRNKIREQNRQDIKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDADTKDESEETVPNPFSQLTDQELEEYKKEVERKKLEQEQEGEKDIATEKPGSPVKSTPASPVQSPSKAGTKSPAVSPSKTSEDTKKTEVSEANTEPEPVKPEGLVVNGKEEEPSVEEALSKGLGQMTTNADTDGDSYKDKTESVTSGPLSPEGSPSKSPSKKKKKFRTPSFLKKSKKKEKVES" ; affx:hasCds [affx:startsAt "86938736" ; affx:stopsAt "86971755" ]; affx:hasExon [ affx:relatesToExon :ADD2_e1; affx:cdsType "Partial" ; affx:cdsStart "86938736" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :ADD2_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :ADD2_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :ADD2_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :ADD2_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :ADD2_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :ADD2_e17; affx:cdsType "Partial" ; affx:cdsStop "86971755" ; affx:frame "0"] ; . :ADD2_e1 a affx:Exon ; affx:startsAt "86938696" ; affx:stopsAt "86938919" ; affx:commonToAll "0" . :ADD2_e2 a affx:Exon ; affx:startsAt "86938736" ; affx:stopsAt "86938919" ; affx:commonToAll "0" . :ADD2_e3 a affx:Exon ; affx:startsAt "86939778" ; affx:stopsAt "86939917" ; affx:commonToAll "1" . :ADD2_e4 a affx:Exon ; affx:startsAt "86945698" ; affx:stopsAt "86945850" ; affx:commonToAll "1" . :ADD2_e5 a affx:Exon ; affx:startsAt "86946276" ; affx:stopsAt "86946357" ; affx:commonToAll "1" . :ADD2_e6 a affx:Exon ; affx:startsAt "86949560" ; affx:stopsAt "86949710" ; affx:commonToAll "1" . :ADD2_e7 a affx:Exon ; affx:startsAt "86951450" ; affx:stopsAt "86951594" ; affx:commonToAll "1" . :ADD2_e8 a affx:Exon ; affx:startsAt "86954029" ; affx:stopsAt "86954128" ; affx:commonToAll "0" . :ADD2_e9 a affx:Exon ; affx:startsAt "86957356" ; affx:stopsAt "86957533" ; affx:commonToAll "0" . :ADD2_e10 a affx:Exon ; affx:startsAt "86958921" ; affx:stopsAt "86959179" ; affx:commonToAll "0" . :ADD2_e11 a affx:Exon ; affx:startsAt "86960229" ; affx:stopsAt "86960349" ; affx:commonToAll "0" . :ADD2_e12 a affx:Exon ; affx:startsAt "86960771" ; affx:stopsAt "86960861" ; affx:commonToAll "0" . :ADD2_e13 a affx:Exon ; affx:startsAt "86960771" ; affx:stopsAt "86961171" ; affx:commonToAll "0" . :ADD2_e14 a affx:Exon ; affx:startsAt "86962583" ; affx:stopsAt "86962737" ; affx:commonToAll "0" . :ADD2_e15 a affx:Exon ; affx:startsAt "86963694" ; affx:stopsAt "86963820" ; affx:commonToAll "0" . :ADD2_e16 a affx:Exon ; affx:startsAt "86971450" ; affx:stopsAt "86971775" ; affx:commonToAll "0" . :ADD2_e17 a affx:Exon ; affx:startsAt "86971450" ; affx:stopsAt "86971799" ; affx:commonToAll "0" . :Gene5025 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi598322] ; affx:hasVariant [affx:representedBy :gi6752951] . :gi598322 a affx:Transcript ; affx:unigene "iMm.16562" ; affx:translatesTo "MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF" ; affx:hasCds [affx:startsAt "84401938" ; affx:stopsAt "84416395" ]; affx:hasExon [ affx:relatesToExon :Gene5025_e1; affx:cdsType "Partial" ; affx:cdsStart "84401938" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e10; affx:cdsType "Partial" ; affx:cdsStop "84416395" ; affx:frame "2"] ; . :gi6752951 a affx:Transcript ; affx:unigene "iMm.16562" ; affx:translatesTo "MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTILSLLLSGSTQSGLAAPSWPLSPPSSKCGSASQSMMRQGPPLSTGNASKVRGPSLGIPTRLLSPATDH" ; affx:hasCds [affx:startsAt "84401877" ; affx:stopsAt "84416395" ]; affx:hasExon [ affx:relatesToExon :Gene5025_e1; affx:cdsType "Partial" ; affx:cdsStart "84401877" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5025_e9; affx:cdsType "Full" ; affx:frame "2"] ; . :Gene5025_e1 a affx:Exon ; affx:startsAt "84401863" ; affx:stopsAt "84402082" ; affx:commonToAll "1" . :Gene5025_e2 a affx:Exon ; affx:startsAt "84405221" ; affx:stopsAt "84405403" ; affx:commonToAll "0" . :Gene5025_e3 a affx:Exon ; affx:startsAt "84405231" ; affx:stopsAt "84405403" ; affx:commonToAll "0" . :Gene5025_e4 a affx:Exon ; affx:startsAt "84408721" ; affx:stopsAt "84408913" ; affx:commonToAll "1" . :Gene5025_e5 a affx:Exon ; affx:startsAt "84409609" ; affx:stopsAt "84409771" ; affx:commonToAll "1" . :Gene5025_e6 a affx:Exon ; affx:startsAt "84411769" ; affx:stopsAt "84411854" ; affx:commonToAll "1" . :Gene5025_e7 a affx:Exon ; affx:startsAt "84412121" ; affx:stopsAt "84412232" ; affx:commonToAll "1" . :Gene5025_e8 a affx:Exon ; affx:startsAt "84415759" ; affx:stopsAt "84415888" ; affx:commonToAll "1" . :Gene5025_e9 a affx:Exon ; affx:startsAt "84416269" ; affx:stopsAt "84416395" ; affx:commonToAll "0" . :Gene5025_e10 a affx:Exon ; affx:startsAt "84416269" ; affx:stopsAt "84416433" ; affx:commonToAll "0" . :Gene5026 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi12805146] . :gi12805146 a affx:Transcript ; affx:unigene "iMm.34384" ; affx:translatesTo "MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD" ; affx:hasCds [affx:startsAt "121700119" ; affx:stopsAt "121707574" ]; affx:hasExon [ affx:relatesToExon :Gene5026_e1; affx:cdsType "Partial" ; affx:cdsStart "121700119" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5026_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5026_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5026_e4; affx:cdsType "Partial" ; affx:cdsStop "121706005" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5026_e5; affx:cdsType "Partial" ; affx:cdsStop "121707574" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5026_e6; affx:cdsType "None" ] ; . :Gene5026_e1 a affx:Exon ; affx:startsAt "121698957" ; affx:stopsAt "121700131" ; affx:commonToAll "1" . :Gene5026_e2 a affx:Exon ; affx:startsAt "121701457" ; affx:stopsAt "121701670" ; affx:commonToAll "1" . :Gene5026_e3 a affx:Exon ; affx:startsAt "121703058" ; affx:stopsAt "121703198" ; affx:commonToAll "1" . :Gene5026_e4 a affx:Exon ; affx:startsAt "121705994" ; affx:stopsAt "121706206" ; affx:commonToAll "1" . :Gene5026_e5 a affx:Exon ; affx:startsAt "121707562" ; affx:stopsAt "121707628" ; affx:commonToAll "1" . :Gene5026_e6 a affx:Exon ; affx:startsAt "121722781" ; affx:stopsAt "121722868" ; affx:commonToAll "1" . :Bet1 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi6753181] . :gi6753181 a affx:Transcript ; affx:unigene "iMm.23564" ; affx:translatesTo "MRRAGLGDGAPPGSYGNYGYANTGYNACEEENDRLTESLRSKVTAIKSLSIEIGHEVKNQNKLLAEMDSQFDSTTGFLGKTMGRLKILSRGSQTKLLCYMMLFSLFVFFVIYWIIKLR" ; affx:hasCds [affx:startsAt "3778983" ; affx:stopsAt "3787898" ]; affx:hasExon [ affx:relatesToExon :Bet1_e1; affx:cdsType "Partial" ; affx:cdsStart "3778983" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Bet1_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Bet1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Bet1_e4; affx:cdsType "Partial" ; affx:cdsStop "3787898" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "96" ; affx:stopsAt "115" ; affx:spannedBy [ affx:startsAt "3778995" ; affx:stopsAt "3779052" ; affx:inFrame "2" ] ; ] ; ] ; . :Bet1_e1 a affx:Exon ; affx:startsAt "3778980" ; affx:stopsAt "3779139" ; affx:commonToAll "1" . :Bet1_e2 a affx:Exon ; affx:startsAt "3781063" ; affx:stopsAt "3781120" ; affx:commonToAll "1" . :Bet1_e3 a affx:Exon ; affx:startsAt "3783560" ; affx:stopsAt "3783685" ; affx:commonToAll "1" . :Bet1_e4 a affx:Exon ; affx:startsAt "3787879" ; affx:stopsAt "3788002" ; affx:commonToAll "1" . :AB041550 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi10946781] . :gi10946781 a affx:Transcript ; affx:unigene "iMm.133192" ; affx:translatesTo "MESSAGDPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDCRGAGRLPRADFRALCAVLGLNADGETATEDANSAEAASTNPAAGMIAGGDADVREEARLALRADPPELTFRQFHARLCGYFSSRAGPRLPRGALSEHIETQIRLRRPRRRRRPGSPSLHGGAYGERVAHLEEENSSLRELVEDLRAALQSSDARCLALQVGLWKSQSDIPEAAAHELQRAQGALAEAEARARRLQRGQVEVRLRTEEARQAVRRSLHRVRELEALARRVPCLQRQVQRLEAELRGYR" ; affx:hasCds [affx:startsAt "88596624" ; affx:stopsAt "88598672" ]; affx:hasExon [ affx:relatesToExon :AB041550_e1; affx:cdsType "Partial" ; affx:cdsStart "88596624" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :AB041550_e2; affx:cdsType "Partial" ; affx:cdsStop "88598672" ; affx:frame "1"] ; . :AB041550_e1 a affx:Exon ; affx:startsAt "88596600" ; affx:stopsAt "88597272" ; affx:commonToAll "1" . :AB041550_e2 a affx:Exon ; affx:startsAt "88598405" ; affx:stopsAt "88599749" ; affx:commonToAll "1" . :Gene5029 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi15029725] ; affx:hasVariant [affx:representedBy :gi8392844] . :gi15029725 a affx:Transcript ; affx:unigene "iMm.4073" ; affx:translatesTo "MMNLAAGFLLMLLEVLLLPGTPLSAEESPASTPGSPLSSTEYERFFALLTPTWKAETTCRLRATHGCRNPTLVQLDQYENHGLVPDGAVCSDLPYASWFESFCQFAQYRCSNHVYYAKRVRCSQPVSILSPNTLKEVESSAEVPPTSMTTPIVSHATATEHQAFQPWPERLNNNVEELLQSSLSLGGKDQQSSRRPGQEQRKQEQIQEHKLEEAQEQEEQEEEEEEEEAKQEEGQGTEAGLESVSRLQSDSEPKFQSQSLSSNPSFFTPRVREVESAPLMMKNIQELIRSAQEMDEMNELYDDSWRSQSTGRYRKL" ; affx:hasCds [affx:startsAt "125936083" ; affx:stopsAt "125940042" ]; affx:hasExon [ affx:relatesToExon :Gene5029_e1; affx:cdsType "Partial" ; affx:cdsStart "125936083" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e7; affx:cdsType "Partial" ; affx:cdsStop "125940042" ; affx:frame "0"] ; . :gi8392844 a affx:Transcript ; affx:unigene "iMm.4073" ; affx:translatesTo "MMNLAAGFLLMLLEVLLLPGTPLSAEESPASTPGSPLSSTEYERFFALLTPTWKAETTCRLRATHGCRNPTLVQLDQYENHGLVPDGAVCSDLPYASWFESFCQFAQYRCSNHVYYAKRVRCSQPVSILSPNTLKEVESSAEVPPTSMTTPIVSHATATEHQAFQPWPERLNNNVEELLQSSLSLGGKDQQSSRRPGQEQRKQEQIQEHKLEEAQEQEEQEEEEEEEEAKQEEGQGTEAGLESVSRLQSDSEPKFQSQSLSSNPSFFTPRVREVESAPLMMKNIQELIRSAQEMDEMNELYDDSWRSQSTGSLQQLPHMETLMVLCYSIMENTCTMTPTAKAWSYMEEEILGFGDSVCDNLGRRHTAACPLCAFCSLKLEQCHSEASVLRQKCDASHKIPFISPLLSAQSISTGNQARIPDKGRFAGLEMYGGLSSEFWCNRLAMKGCEDDRVSNWLKAEFLSFQEGDFPTKICDTNYIQYPNYCSFKSQQCLLRNQNRKMSRMRCMLNERYNVLSLAKSEEVILRWSQEFSTLAIGQFG" ; affx:hasCds [affx:startsAt "125936083" ; affx:stopsAt "125949407" ]; affx:hasExon [ affx:relatesToExon :Gene5029_e2; affx:cdsType "Partial" ; affx:cdsStart "125936083" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5029_e12; affx:cdsType "Partial" ; affx:cdsStop "125949407" ; affx:frame "0"] ; . :Gene5029_e1 a affx:Exon ; affx:startsAt "125935762" ; affx:stopsAt "125936126" ; affx:commonToAll "0" . :Gene5029_e2 a affx:Exon ; affx:startsAt "125936048" ; affx:stopsAt "125936126" ; affx:commonToAll "0" . :Gene5029_e3 a affx:Exon ; affx:startsAt "125936507" ; affx:stopsAt "125936723" ; affx:commonToAll "1" . :Gene5029_e4 a affx:Exon ; affx:startsAt "125936920" ; affx:stopsAt "125937015" ; affx:commonToAll "1" . :Gene5029_e5 a affx:Exon ; affx:startsAt "125937316" ; affx:stopsAt "125937434" ; affx:commonToAll "1" . :Gene5029_e6 a affx:Exon ; affx:startsAt "125939563" ; affx:stopsAt "125940026" ; affx:commonToAll "0" . :Gene5029_e7 a affx:Exon ; affx:startsAt "125939563" ; affx:stopsAt "125940266" ; affx:commonToAll "0" . :Gene5029_e8 a affx:Exon ; affx:startsAt "125941021" ; affx:stopsAt "125941154" ; affx:commonToAll "0" . :Gene5029_e9 a affx:Exon ; affx:startsAt "125947158" ; affx:stopsAt "125947338" ; affx:commonToAll "0" . :Gene5029_e10 a affx:Exon ; affx:startsAt "125947434" ; affx:stopsAt "125947602" ; affx:commonToAll "0" . :Gene5029_e11 a affx:Exon ; affx:startsAt "125948784" ; affx:stopsAt "125948868" ; affx:commonToAll "0" . :Gene5029_e12 a affx:Exon ; affx:startsAt "125949284" ; affx:stopsAt "125949592" ; affx:commonToAll "0" . :Gene5030 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi5714369] ; affx:hasVariant [affx:representedBy :gi7304888] . :gi5714369 a affx:Transcript ; affx:unigene "iMm.619" ; affx:translatesTo "MEAKGGTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALMKQDAQVFQHSWIPDLFLTLRTQQGS" ; affx:hasCds [affx:startsAt "87608431" ; affx:stopsAt "87623348" ]; affx:hasExon [ affx:relatesToExon :Gene5030_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5030_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5030_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5030_e4; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5030_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene5030_e7; affx:cdsType "Partial" ; affx:cdsStart "87608431" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e14; affx:cdsType "Partial" ; affx:cdsStop "87623348" ; affx:frame "2"] ; . :gi7304888 a affx:Transcript ; affx:unigene "iMm.619" ; affx:translatesTo "MEAKGGTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALMKQDAQELYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD" ; affx:hasCds [affx:startsAt "87595383" ; affx:stopsAt "87623348" ]; affx:hasExon [ affx:relatesToExon :Gene5030_e1; affx:cdsType "Partial" ; affx:cdsStart "87595383" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5030_e14; affx:cdsType "Partial" ; affx:cdsStop "87623348" ; affx:frame "2"] ; . :Gene5030_e1 a affx:Exon ; affx:startsAt "87594466" ; affx:stopsAt "87595443" ; affx:commonToAll "1" . :Gene5030_e2 a affx:Exon ; affx:startsAt "87599455" ; affx:stopsAt "87599578" ; affx:commonToAll "1" . :Gene5030_e3 a affx:Exon ; affx:startsAt "87600737" ; affx:stopsAt "87600796" ; affx:commonToAll "1" . :Gene5030_e4 a affx:Exon ; affx:startsAt "87602244" ; affx:stopsAt "87602340" ; affx:commonToAll "1" . :Gene5030_e5 a affx:Exon ; affx:startsAt "87606467" ; affx:stopsAt "87606560" ; affx:commonToAll "0" . :Gene5030_e6 a affx:Exon ; affx:startsAt "87606467" ; affx:stopsAt "87606561" ; affx:commonToAll "0" . :Gene5030_e7 a affx:Exon ; affx:startsAt "87607808" ; affx:stopsAt "87608494" ; affx:commonToAll "0" . :Gene5030_e8 a affx:Exon ; affx:startsAt "87608643" ; affx:stopsAt "87608700" ; affx:commonToAll "1" . :Gene5030_e9 a affx:Exon ; affx:startsAt "87609733" ; affx:stopsAt "87609813" ; affx:commonToAll "1" . :Gene5030_e10 a affx:Exon ; affx:startsAt "87611383" ; affx:stopsAt "87611474" ; affx:commonToAll "1" . :Gene5030_e11 a affx:Exon ; affx:startsAt "87612433" ; affx:stopsAt "87612547" ; affx:commonToAll "1" . :Gene5030_e12 a affx:Exon ; affx:startsAt "87615398" ; affx:stopsAt "87615493" ; affx:commonToAll "1" . :Gene5030_e13 a affx:Exon ; affx:startsAt "87618253" ; affx:stopsAt "87618341" ; affx:commonToAll "1" . :Gene5030_e14 a affx:Exon ; affx:startsAt "87623345" ; affx:stopsAt "87623393" ; affx:commonToAll "1" . :Gene5031 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi4106463] . :gi4106463 a affx:Transcript ; affx:unigene "iMm.86453" ; affx:translatesTo "MSSDGEPLSRMDSEDSISSTLMDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEESGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRFDILNFPR" ; affx:hasCds [affx:startsAt "141198443" ; affx:stopsAt "141253400" ]; affx:hasExon [ affx:relatesToExon :Gene5031_e1; affx:cdsType "Partial" ; affx:cdsStart "141198443" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5031_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5031_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5031_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5031_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5031_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5031_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5031_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5031_e9; affx:cdsType "Partial" ; affx:cdsStop "141253400" ; affx:frame "0"] ; . :Gene5031_e1 a affx:Exon ; affx:startsAt "141198371" ; affx:stopsAt "141198490" ; affx:commonToAll "1" . :Gene5031_e2 a affx:Exon ; affx:startsAt "141207834" ; affx:stopsAt "141208042" ; affx:commonToAll "1" . :Gene5031_e3 a affx:Exon ; affx:startsAt "141211805" ; affx:stopsAt "141211913" ; affx:commonToAll "1" . :Gene5031_e4 a affx:Exon ; affx:startsAt "141216317" ; affx:stopsAt "141216504" ; affx:commonToAll "1" . :Gene5031_e5 a affx:Exon ; affx:startsAt "141218093" ; affx:stopsAt "141218218" ; affx:commonToAll "1" . :Gene5031_e6 a affx:Exon ; affx:startsAt "141220955" ; affx:stopsAt "141221023" ; affx:commonToAll "1" . :Gene5031_e7 a affx:Exon ; affx:startsAt "141222117" ; affx:stopsAt "141222231" ; affx:commonToAll "1" . :Gene5031_e8 a affx:Exon ; affx:startsAt "141224901" ; affx:stopsAt "141224928" ; affx:commonToAll "1" . :Gene5031_e9 a affx:Exon ; affx:startsAt "141253372" ; affx:stopsAt "141254454" ; affx:commonToAll "1" . :Apobec1 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi899508] . :gi899508 a affx:Transcript ; affx:unigene "iMm.3333" ; affx:translatesTo "MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSVWRHTSQNTSNHVEVNFLEKFTTERYFRPNTRCSITWFLSWSPCGECSRAITEFLSRHPYVTLFIYIARLYHHTDQRNRQGLRDLISSGVTIQIMTEQEYCYCWRNFVNYPPSNEAYWPRYPHLWVKLYVLELYCIILGLPPCLKILRRKQPQLTFFTITLQTCHYQRIPPHLLWATGLK" ; affx:hasCds [affx:startsAt "123627869" ; affx:stopsAt "123640165" ]; affx:hasExon [ affx:relatesToExon :Apobec1_e1; affx:cdsType "Partial" ; affx:cdsStart "123627869" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Apobec1_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Apobec1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Apobec1_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Apobec1_e5; affx:cdsType "Partial" ; affx:cdsStop "123640165" ; affx:frame "0"] ; . :Apobec1_e1 a affx:Exon ; affx:startsAt "123626854" ; affx:stopsAt "123627998" ; affx:commonToAll "1" . :Apobec1_e2 a affx:Exon ; affx:startsAt "123629750" ; affx:stopsAt "123629869" ; affx:commonToAll "1" . :Apobec1_e3 a affx:Exon ; affx:startsAt "123630415" ; affx:stopsAt "123630813" ; affx:commonToAll "1" . :Apobec1_e4 a affx:Exon ; affx:startsAt "123637207" ; affx:stopsAt "123637235" ; affx:commonToAll "1" . :Apobec1_e5 a affx:Exon ; affx:startsAt "123640149" ; affx:stopsAt "123640425" ; affx:commonToAll "1" . :AID a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi5305727] . :gi5305727 a affx:Transcript ; affx:unigene "iMm.32398" ; affx:translatesTo "MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF" ; affx:hasCds [affx:startsAt "123603117" ; affx:stopsAt "123611411" ]; affx:hasExon [ affx:relatesToExon :AID_e1; affx:cdsType "Partial" ; affx:cdsStart "123603117" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :AID_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :AID_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :AID_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :AID_e5; affx:cdsType "Partial" ; affx:cdsStop "123611411" ; affx:frame "1"] ; . :AID_e1 a affx:Exon ; affx:startsAt "123603033" ; affx:stopsAt "123603125" ; affx:commonToAll "1" . :AID_e2 a affx:Exon ; affx:startsAt "123608493" ; affx:stopsAt "123608641" ; affx:commonToAll "1" . :AID_e3 a affx:Exon ; affx:startsAt "123610063" ; affx:stopsAt "123610334" ; affx:commonToAll "1" . :AID_e4 a affx:Exon ; affx:startsAt "123610863" ; affx:stopsAt "123610979" ; affx:commonToAll "1" . :AID_e5 a affx:Exon ; affx:startsAt "123611357" ; affx:stopsAt "123613118" ; affx:commonToAll "1" . :Akap3 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi6753025] . :gi6753025 a affx:Transcript ; affx:unigene "iMm.87748" ; affx:translatesTo "MADRVDWLQSQSGVCKVGVYSPGDNQHQDWKMDTSTDPVRVLSWLRKDLEKSTAGFQDSRFKPGESSFVEEVAYPVDQRKGFCVDYYNTTNKGSPGRLHFEMSHKENPSQGLISHVGNGGSIDEVSFYANRLTNLVIAMARKEINEKIHGAENKCVHQSLYMGDEPTPHKSLSTVASELVNETVTACSKNISSDKAPGSGDRASGSSQAPGLRYTSTLKIKESTKEGKCPDDKPGTKKSFFYKEVFESRNAGDAKEGGRSLPGDQKLFRTSPDNRPDDFSNSISQGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATILLKKVLMKHAKEVVSDLIDSFMKNLHGVTGSLMTDTDFVSAVKRSFFSHGSQKATDIMDAMLGKLYNVMFAKKFPENIRRARDKSESYSLISTKSRAGDPKLSNLNFAMKSESKLKENLFSTCKLEKEKTCAETLGEHIIKEGLHMWHKSQQKSPGLERAAKLGNAPQEVSFECPDPCEANPPHQPQPPENFANFMCDSDSWAKDLIVSALLLIQYHLAQGGKMDAQSFLEAAASTNFPTNKPPPPSPVVQDECKLKSPPHKICDQEQTEKKDLMSVIFNFIRNLLSETIFKSSRNCESNVHEQNTQEEEIHPCERPKTPCERPITPPAPKFCEDEEATGGALSGLTKMVANQLDNCMNGQMVEHLMDSVMKLCLIIAKSCDSPLSELGEEKCGDASRPNSAFPDNLYECLPVKGTGTAEALLQNAYLTIHNELRGLSGQPPEGCEIPKVIVSNHNLADTVQNKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSATAVEKGRSVGEVLQSVLRYEKERQLDEAVGNVTRLQLLDWLMANL" ; affx:hasCds [affx:startsAt "127757734" ; affx:stopsAt "127771341" ]; affx:hasExon [ affx:relatesToExon :Akap3_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Akap3_e2; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Akap3_e3; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Akap3_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Akap3_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Akap3_e6; affx:cdsType "Partial" ; affx:cdsStop "127771341" ; affx:frame "2"] ; . :Akap3_e1 a affx:Exon ; affx:startsAt "127750440" ; affx:stopsAt "127750518" ; affx:commonToAll "1" . :Akap3_e2 a affx:Exon ; affx:startsAt "127753533" ; affx:stopsAt "127753634" ; affx:commonToAll "1" . :Akap3_e3 a affx:Exon ; affx:startsAt "127754580" ; affx:stopsAt "127754691" ; affx:commonToAll "1" . :Akap3_e4 a affx:Exon ; affx:startsAt "127757734" ; affx:stopsAt "127757830" ; affx:commonToAll "1" . :Akap3_e5 a affx:Exon ; affx:startsAt "127761995" ; affx:stopsAt "127764338" ; affx:commonToAll "1" . :Akap3_e6 a affx:Exon ; affx:startsAt "127771185" ; affx:stopsAt "127771534" ; affx:commonToAll "1" . :Gene5035 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi3080547] . :gi3080547 a affx:Transcript ; affx:unigene "iMm.4694" ; affx:translatesTo "MATTGALGNYYVDSFLLGADAADELGAGRYAPGTLGQPPRQAAALAEHPDFSPCSFQSKAAVFGASWNPVHAAGANAVPAAVYHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE" ; affx:hasCds [affx:startsAt "52614827" ; affx:stopsAt "52616690" ]; affx:hasExon [ affx:relatesToExon :Gene5035_e1; affx:cdsType "Partial" ; affx:cdsStart "52614827" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5035_e2; affx:cdsType "Partial" ; affx:cdsStop "52616690" ; affx:frame "0"] ; . :Gene5035_e1 a affx:Exon ; affx:startsAt "52614738" ; affx:stopsAt "52615066" ; affx:commonToAll "1" . :Gene5035_e2 a affx:Exon ; affx:startsAt "52616113" ; affx:stopsAt "52617956" ; affx:commonToAll "1" . :hnRNP_A2_B1 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi3329497] . :gi3329497 a affx:Transcript ; affx:unigene "iMm.16767" ; affx:translatesTo "MEREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY" ; affx:hasCds [affx:startsAt "51854318" ; affx:stopsAt "51860563" ]; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e2; affx:cdsType "Partial" ; affx:cdsStart "51854318" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :hnRNP_A2_B1_e11; affx:cdsType "Partial" ; affx:cdsStop "51860563" ; affx:frame "2"] ; . :hnRNP_A2_B1_e1 a affx:Exon ; affx:startsAt "51853646" ; affx:stopsAt "51854141" ; affx:commonToAll "1" . :hnRNP_A2_B1_e2 a affx:Exon ; affx:startsAt "51854297" ; affx:stopsAt "51854380" ; affx:commonToAll "1" . :hnRNP_A2_B1_e3 a affx:Exon ; affx:startsAt "51854975" ; affx:stopsAt "51855098" ; affx:commonToAll "1" . :hnRNP_A2_B1_e4 a affx:Exon ; affx:startsAt "51855314" ; affx:stopsAt "51855434" ; affx:commonToAll "1" . :hnRNP_A2_B1_e5 a affx:Exon ; affx:startsAt "51856065" ; affx:stopsAt "51856128" ; affx:commonToAll "1" . :hnRNP_A2_B1_e6 a affx:Exon ; affx:startsAt "51857028" ; affx:stopsAt "51857109" ; affx:commonToAll "1" . :hnRNP_A2_B1_e7 a affx:Exon ; affx:startsAt "51857189" ; affx:stopsAt "51857291" ; affx:commonToAll "1" . :hnRNP_A2_B1_e8 a affx:Exon ; affx:startsAt "51857381" ; affx:stopsAt "51857592" ; affx:commonToAll "1" . :hnRNP_A2_B1_e9 a affx:Exon ; affx:startsAt "51857792" ; affx:stopsAt "51857939" ; affx:commonToAll "1" . :hnRNP_A2_B1_e10 a affx:Exon ; affx:startsAt "51858071" ; affx:stopsAt "51858182" ; affx:commonToAll "1" . :hnRNP_A2_B1_e11 a affx:Exon ; affx:startsAt "51860557" ; affx:stopsAt "51860659" ; affx:commonToAll "1" . :Hox11l1 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi6678366] . :gi6678366 a affx:Transcript ; affx:unigene "iMm.37" ; affx:translatesTo "MEPAVLAAHHLPHHEPISFGIDQILSGPEPPGGGLGPGQSGQSHGESAAFSSGFHGASGYAPAGSLASLPRGSGVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV" ; affx:hasCds [affx:startsAt "83956659" ; affx:stopsAt "83957981" ]; affx:hasExon [ affx:relatesToExon :Hox11l1_e1; affx:cdsType "Partial" ; affx:cdsStart "83956659" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hox11l1_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Hox11l1_e3; affx:cdsType "Partial" ; affx:cdsStop "83957981" ; affx:frame "0"] ; . :Hox11l1_e1 a affx:Exon ; affx:startsAt "83956492" ; affx:stopsAt "83956876" ; affx:commonToAll "1" . :Hox11l1_e2 a affx:Exon ; affx:startsAt "83956955" ; affx:stopsAt "83957193" ; affx:commonToAll "1" . :Hox11l1_e3 a affx:Exon ; affx:startsAt "83957581" ; affx:stopsAt "83958045" ; affx:commonToAll "1" . :Gene5038 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi309216] . :gi309216 a affx:Transcript ; affx:unigene "iMm.2012" ; affx:translatesTo "MNGHMSNRSSGYGVYPSQLNGYGSSPPYSQMDREHSSRTSAKALYEQRKNYARDSVSSVSDVSQYRVEHLTTFVLDRKDAMITVEDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTISHCQAVVHACSYDSILALVCKEPTQSKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPEALRMIAKADPGIPPPPRAPAPVPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKSKKSKRKGPGEGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQNPSASDLVHFLFTPLNMVVQATGGPELASSVLSPLLTKDTVDFLNYTATAEERKLWMSLGDSWVKVRAEWPKEQFIPPYVPRFRNGWEPPMLNFMGAPTEQDMYQLAESVANAEHQRKQDSKRLSTEHSNVSDYPPADGYAYSSSMYHRGPHADHGEAAMPFKSTPNHQVDRNYDAVKTQPKKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPESGVGRADPPYTHTIQKQRTEYGLRSADTPSAPSPPPTPAPVPVPLPPSVPAPVSVPKVPANVTRQNSSSSDSGGSIVRDSQRYKQLPVDRRKSQMEEVQDELFQRLTIGRSAAQRKFHVPRQNVPVINITYDSSPEEVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRSVCPEGARVFNQITVQKAALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH" ; affx:hasCds [affx:startsAt "137874538" ; affx:stopsAt "137935255" ]; affx:hasExon [ affx:relatesToExon :Gene5038_e1; affx:cdsType "Partial" ; affx:cdsStart "137874538" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e20; affx:cdsType "Partial" ; affx:cdsStop "137935255" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5038_e21; affx:cdsType "None" ] ; . :Gene5038_e1 a affx:Exon ; affx:startsAt "137873699" ; affx:stopsAt "137874652" ; affx:commonToAll "1" . :Gene5038_e2 a affx:Exon ; affx:startsAt "137877674" ; affx:stopsAt "137877804" ; affx:commonToAll "1" . :Gene5038_e3 a affx:Exon ; affx:startsAt "137879064" ; affx:stopsAt "137879245" ; affx:commonToAll "1" . :Gene5038_e4 a affx:Exon ; affx:startsAt "137885742" ; affx:stopsAt "137885965" ; affx:commonToAll "1" . :Gene5038_e5 a affx:Exon ; affx:startsAt "137895172" ; affx:stopsAt "137895316" ; affx:commonToAll "1" . :Gene5038_e6 a affx:Exon ; affx:startsAt "137896125" ; affx:stopsAt "137896234" ; affx:commonToAll "1" . :Gene5038_e7 a affx:Exon ; affx:startsAt "137900978" ; affx:stopsAt "137901112" ; affx:commonToAll "1" . :Gene5038_e8 a affx:Exon ; affx:startsAt "137904672" ; affx:stopsAt "137904853" ; affx:commonToAll "1" . :Gene5038_e9 a affx:Exon ; affx:startsAt "137907945" ; affx:stopsAt "137908094" ; affx:commonToAll "1" . :Gene5038_e10 a affx:Exon ; affx:startsAt "137910074" ; affx:stopsAt "137910149" ; affx:commonToAll "1" . :Gene5038_e11 a affx:Exon ; affx:startsAt "137910499" ; affx:stopsAt "137910588" ; affx:commonToAll "1" . :Gene5038_e12 a affx:Exon ; affx:startsAt "137912867" ; affx:stopsAt "137912994" ; affx:commonToAll "1" . :Gene5038_e13 a affx:Exon ; affx:startsAt "137915317" ; affx:stopsAt "137915391" ; affx:commonToAll "1" . :Gene5038_e14 a affx:Exon ; affx:startsAt "137918027" ; affx:stopsAt "137918164" ; affx:commonToAll "1" . :Gene5038_e15 a affx:Exon ; affx:startsAt "137918704" ; affx:stopsAt "137918787" ; affx:commonToAll "1" . :Gene5038_e16 a affx:Exon ; affx:startsAt "137922962" ; affx:stopsAt "137923112" ; affx:commonToAll "1" . :Gene5038_e17 a affx:Exon ; affx:startsAt "137923242" ; affx:stopsAt "137923404" ; affx:commonToAll "1" . :Gene5038_e18 a affx:Exon ; affx:startsAt "137924399" ; affx:stopsAt "137924467" ; affx:commonToAll "1" . :Gene5038_e19 a affx:Exon ; affx:startsAt "137933492" ; affx:stopsAt "137933569" ; affx:commonToAll "1" . :Gene5038_e20 a affx:Exon ; affx:startsAt "137935196" ; affx:stopsAt "137935279" ; affx:commonToAll "1" . :Gene5038_e21 a affx:Exon ; affx:startsAt "138046648" ; affx:stopsAt "138046818" ; affx:commonToAll "1" . :Eno2 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi7305026] . :gi7305026 a affx:Transcript ; affx:unigene "iMm.3913" ; affx:translatesTo "MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSRIAPALISSGISVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERDLPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKMVIGMDVAASEFYRDGKYDLDFKSPADPSRYITGDQLGALYQDFVRNYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL" ; affx:hasCds [affx:startsAt "125647853" ; affx:stopsAt "125654883" ]; affx:hasExon [ affx:relatesToExon :Eno2_e1; affx:cdsType "Partial" ; affx:cdsStart "125647853" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Eno2_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Eno2_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Eno2_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Eno2_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Eno2_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Eno2_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Eno2_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Eno2_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Eno2_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Eno2_e11; affx:cdsType "Partial" ; affx:cdsStop "125654883" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Eno2_e12; affx:cdsType "None" ] ; . :Eno2_e1 a affx:Exon ; affx:startsAt "125646925" ; affx:stopsAt "125647923" ; affx:commonToAll "1" . :Eno2_e2 a affx:Exon ; affx:startsAt "125648208" ; affx:stopsAt "125648267" ; affx:commonToAll "1" . :Eno2_e3 a affx:Exon ; affx:startsAt "125649213" ; affx:stopsAt "125649322" ; affx:commonToAll "1" . :Eno2_e4 a affx:Exon ; affx:startsAt "125649565" ; affx:stopsAt "125649767" ; affx:commonToAll "1" . :Eno2_e5 a affx:Exon ; affx:startsAt "125650287" ; affx:stopsAt "125650485" ; affx:commonToAll "1" . :Eno2_e6 a affx:Exon ; affx:startsAt "125652665" ; affx:stopsAt "125652888" ; affx:commonToAll "1" . :Eno2_e7 a affx:Exon ; affx:startsAt "125653091" ; affx:stopsAt "125653225" ; affx:commonToAll "1" . :Eno2_e8 a affx:Exon ; affx:startsAt "125653593" ; affx:stopsAt "125653663" ; affx:commonToAll "1" . :Eno2_e9 a affx:Exon ; affx:startsAt "125654100" ; affx:stopsAt "125654159" ; affx:commonToAll "1" . :Eno2_e10 a affx:Exon ; affx:startsAt "125654261" ; affx:stopsAt "125654357" ; affx:commonToAll "1" . :Eno2_e11 a affx:Exon ; affx:startsAt "125654798" ; affx:stopsAt "125654898" ; affx:commonToAll "1" . :Eno2_e12 a affx:Exon ; affx:startsAt "125656216" ; affx:stopsAt "125656314" ; affx:commonToAll "1" . :Gene5040 a affx:Gene ; affx:strand "+" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi4107512] . :gi4107512 a affx:Transcript ; affx:unigene "iMm.23375" ; affx:translatesTo "MERATRPGPRALLLLLFLLLGCAAGISAVAPARSLLAPASETVFGLGAAAAPTSAARVPAVATAEVTVEDAEALPAAAGEPESRATEPDDDVELRPRGRSLVIISTLDGRIAALDAENDGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMEAVPFTVESLLESSYKFGDDVVLVGGKSLTTYGLSAYSGKLRYICSALGCRRWDSDEMEEEEDILLLQRTQKTVRAVGPRSGSEKWNFSVGHFELRYIPDMETRAGFIESTFKPGGNKEDSKIISDVEEQEATMLDTVIKVSVADWKVMAFSRKGGRLEWEYQFCTPIASAWLVRDGKVIPISLFDDTSYTASEEALGDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRVSEKFPTSPKALESVNGENAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKYSHEEYSNGALSILQYPYDNGYYLPYYKRERNKRSTQITVRFLDSPHYSKNIRKKDPILLLHWWKEIFGTILLCIVATTFIVRRLFHPQPHRQRKESETQCQTESKYDSVSADVSDNSWNDMKYSGYVSRYLTDFEPIQCMGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLETPPEKWQEEMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEQIEVIAPSPERSRSFSVGISCGQTSSSESQFSPLEFSGTDCGDNSDSADAAYNLQDSCLTDCEDVEDGTVDGNDEGHSFELCPSEASPYTRSREGTSSSIVFEDSGCGNASSKEEPRGNRLHDGNHYVNKLTDLKCSSSRSSSEATTLSTSPTRPTTLSLDFTKNTVGQLQPSSPKVYLYIQMQLCRKENLKDWMNRRCSLEDREHGVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDEEEQTVLTPMPAYATHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFSTQMERVRILTDVRNLKFPLLFTQKYPQEHMMVQDMLSPSPTERPEATDIIENAIFENLEFPGKTVLRQRSRSMSSSGTKHSRQPSCSYSPLPGN" ; affx:hasCds [affx:startsAt "71697601" ; affx:stopsAt "71768054" ]; affx:hasExon [ affx:relatesToExon :Gene5040_e1; affx:cdsType "Partial" ; affx:cdsStart "71697601" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene5040_e17; affx:cdsType "Partial" ; affx:cdsStop "71768054" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "28" ; affx:spannedBy [ affx:startsAt "71697601" ; affx:stopsAt "71697685" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene5040_e1 a affx:Exon ; affx:startsAt "71697410" ; affx:stopsAt "71697897" ; affx:commonToAll "1" . :Gene5040_e2 a affx:Exon ; affx:startsAt "71711265" ; affx:stopsAt "71711395" ; affx:commonToAll "1" . :Gene5040_e3 a affx:Exon ; affx:startsAt "71732119" ; affx:stopsAt "71732314" ; affx:commonToAll "1" . :Gene5040_e4 a affx:Exon ; affx:startsAt "71734276" ; affx:stopsAt "71734410" ; affx:commonToAll "1" . :Gene5040_e5 a affx:Exon ; affx:startsAt "71736925" ; affx:stopsAt "71737160" ; affx:commonToAll "1" . :Gene5040_e6 a affx:Exon ; affx:startsAt "71737706" ; affx:stopsAt "71737869" ; affx:commonToAll "1" . :Gene5040_e7 a affx:Exon ; affx:startsAt "71739036" ; affx:stopsAt "71739177" ; affx:commonToAll "1" . :Gene5040_e8 a affx:Exon ; affx:startsAt "71740211" ; affx:stopsAt "71740334" ; affx:commonToAll "1" . :Gene5040_e9 a affx:Exon ; affx:startsAt "71740602" ; affx:stopsAt "71740823" ; affx:commonToAll "1" . :Gene5040_e10 a affx:Exon ; affx:startsAt "71743241" ; affx:stopsAt "71743354" ; affx:commonToAll "1" . :Gene5040_e11 a affx:Exon ; affx:startsAt "71744916" ; affx:stopsAt "71745039" ; affx:commonToAll "1" . :Gene5040_e12 a affx:Exon ; affx:startsAt "71745506" ; affx:stopsAt "71745656" ; affx:commonToAll "1" . :Gene5040_e13 a affx:Exon ; affx:startsAt "71747796" ; affx:stopsAt "71748583" ; affx:commonToAll "1" . :Gene5040_e14 a affx:Exon ; affx:startsAt "71752357" ; affx:stopsAt "71752525" ; affx:commonToAll "1" . :Gene5040_e15 a affx:Exon ; affx:startsAt "71755673" ; affx:stopsAt "71755775" ; affx:commonToAll "1" . :Gene5040_e16 a affx:Exon ; affx:startsAt "71756846" ; affx:stopsAt "71756909" ; affx:commonToAll "1" . :Gene5040_e17 a affx:Exon ; affx:startsAt "71767853" ; affx:stopsAt "71769004" ; affx:commonToAll "1" . :Hoxa10 a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi6680242] . :gi6680242 a affx:Transcript ; affx:unigene "iMm.5" ; affx:translatesTo "MSCSESPAANSFLVDSLISSGRGEAGVGGGSAGGGGGGYYAHGGVYLPPASDLPYGLQSCGLFPALGSKRNEAPSPGGGGGGGSGGLGPGTHGYAPAPLDLWLDAPRSCRMEPPDGPPPPQPQPQQQQQQPPPPPPQPPQPQPQATSCSFAQNIKEESSYCLYDAADKCPKGSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQAYGTAKGFGSGGGGTQQLASPFPAQPPGRGFDPPPALASGSTEAAGKERVLDSTPPPTLVCTGGGGSQGDEEAHASSSAAEELSPAPSENSKASPEKDSLGSSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" ; affx:hasCds [affx:startsAt "52623091" ; affx:stopsAt "52625469" ]; affx:hasExon [ affx:relatesToExon :Hoxa10_e1; affx:cdsType "Partial" ; affx:cdsStart "52623091" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Hoxa10_e2; affx:cdsType "Partial" ; affx:cdsStop "52625469" ; affx:frame "0"] ; . :Hoxa10_e1 a affx:Exon ; affx:startsAt "52621782" ; affx:stopsAt "52623366" ; affx:commonToAll "1" . :Hoxa10_e2 a affx:Exon ; affx:startsAt "52624544" ; affx:stopsAt "52625525" ; affx:commonToAll "1" . :hcp a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi193807] . :gi193807 a affx:Transcript ; affx:unigene "iMm.1484" ; affx:translatesTo "MVRWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGILQDRDGTIIHLKYPLNCSDPTSERWYHGHISGGQAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCEGGRYTVGGSETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYVKNQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGRNKCVPYWPEVGTQRVYGLYSVTNSREHDTAEYKLRTLQISPLDNGDLVREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQSQKGQESEYGNITYPPAVRSAHAKASRTSSKHKEEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK" ; affx:hasCds [affx:startsAt "125606503" ; affx:stopsAt "125618360" ]; affx:hasExon [ affx:relatesToExon :hcp_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :hcp_e2; affx:cdsType "Partial" ; affx:cdsStart "125606503" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hcp_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hcp_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :hcp_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :hcp_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hcp_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :hcp_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hcp_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :hcp_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hcp_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hcp_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :hcp_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :hcp_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :hcp_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :hcp_e16; affx:cdsType "Partial" ; affx:cdsStop "125618360" ; affx:frame "1"] ; . :hcp_e1 a affx:Exon ; affx:startsAt "125606112" ; affx:stopsAt "125606304" ; affx:commonToAll "1" . :hcp_e2 a affx:Exon ; affx:startsAt "125606475" ; affx:stopsAt "125606618" ; affx:commonToAll "1" . :hcp_e3 a affx:Exon ; affx:startsAt "125606971" ; affx:stopsAt "125607063" ; affx:commonToAll "1" . :hcp_e4 a affx:Exon ; affx:startsAt "125607158" ; affx:stopsAt "125607310" ; affx:commonToAll "1" . :hcp_e5 a affx:Exon ; affx:startsAt "125607406" ; affx:stopsAt "125607474" ; affx:commonToAll "1" . :hcp_e6 a affx:Exon ; affx:startsAt "125610360" ; affx:stopsAt "125610515" ; affx:commonToAll "1" . :hcp_e7 a affx:Exon ; affx:startsAt "125610630" ; affx:stopsAt "125610762" ; affx:commonToAll "1" . :hcp_e8 a affx:Exon ; affx:startsAt "125612790" ; affx:stopsAt "125612940" ; affx:commonToAll "1" . :hcp_e9 a affx:Exon ; affx:startsAt "125613121" ; affx:stopsAt "125613201" ; affx:commonToAll "1" . :hcp_e10 a affx:Exon ; affx:startsAt "125613517" ; affx:stopsAt "125613614" ; affx:commonToAll "1" . :hcp_e11 a affx:Exon ; affx:startsAt "125613742" ; affx:stopsAt "125613856" ; affx:commonToAll "1" . :hcp_e12 a affx:Exon ; affx:startsAt "125613953" ; affx:stopsAt "125614070" ; affx:commonToAll "1" . :hcp_e13 a affx:Exon ; affx:startsAt "125614186" ; affx:stopsAt "125614376" ; affx:commonToAll "1" . :hcp_e14 a affx:Exon ; affx:startsAt "125617706" ; affx:stopsAt "125617901" ; affx:commonToAll "1" . :hcp_e15 a affx:Exon ; affx:startsAt "125618144" ; affx:stopsAt "125618267" ; affx:commonToAll "1" . :hcp_e16 a affx:Exon ; affx:startsAt "125618352" ; affx:stopsAt "125618513" ; affx:commonToAll "1" . :1700041H07Rik a affx:Gene ; affx:strand "-" ; affx:chr "chr6" ; affx:hasVariant [affx:representedBy :gi16905092] . :gi16905092 a affx:Transcript ; affx:unigene "iMm.50808" ; affx:translatesTo "MEIDHSDSVEIINKYEPIEEVKGERQMSIEGFARYMFSSECLLFKENCKTVYQDMNHPLSDYFISSSHNTYLISDQILGPSDIWGYVSALVKGCRCLEIDCWDGSQNEPIVYHGYTFTSKLLFKTVVQAINKYAFVTSDYPVVLSLENHCSPGQQEVMASILQSTFGDFLLSDMLEEFPDTLPSPEALKFKILVKNRKVGTLSETHERIGTDKSGQVLEWKEVIYEDGDEDSGMDPETWDVFLSRIKEEREADPSTLSGIAGVKKRKRKMKIAMALSDLVIYTKAEKFRNFQYSRVYQQFNETNSIGESRARKLSKLRVHEFIFHTAAFITRVYPKMMRADSSNFNPQEFWNVGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPDILRDTTLGFNPNEPEYDDHPVTLTIRIISGIQLPVSSSSNTPDIVVIIEVYGVPNDHVKQQTRVVKNNAFSPKWNETFTFLIQVPELALIRFVVETQQGLLSGNELLGQYTLPVLCMNKGYRRVPLFSKSGANLEPSSLFIYVWYFRE" ; affx:hasCds [affx:startsAt "140557292" ; affx:stopsAt "140596143" ]; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e1; affx:cdsType "Partial" ; affx:cdsStart "140557292" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e11; affx:cdsType "Partial" ; affx:cdsStop "140596143" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e12; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :1700041H07Rik_e13; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :1700041H07R