# Test data in notation3 http://www.w3.org/DesignIssues/Notation3.html # @prefix affx: . @prefix rdfs: . @prefix owl: . @prefix : <#> . affx:Gene a owl:Class ; owl:hasProperty affx:onStrand ; owl:hasProperty affx:onChr ; owl:hasProperty affx:hasVariant . affx:onStrand a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The strand on which the gene exists" . affx:onChr a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The chromosome on which the gene exists" . affx:hasVariant a owl:ObjectProperty ; owl:domain affx:Gene ; owl:range affx:SpliceVariant ; owl:minCardinality "1" ; rdfs:comment "For associating variants to genes" . affx:SpliceVariant a owl:Class ; owl:hasProperty affx:representedBy . affx:representedBy a owl:ObjectProperty ; owl:domain affx:SpliceVariant ; owl:range affx:Transcript ; owl:minCardinality "1" ; rdfs:comment "In this data, each splice variant is represented by one transcript" . affx:Transcript a owl:Class ; owl:hasProperty affx:unigene ; owl:hasProperty affx:translatesTo ; owl:hasProperty affx:fullCds ; owl:hasProperty affx:hasExon ; owl:hasProperty affx:signalPHit ; owl:hasProperty affx:tmHMMHit ; rdfs:comment "A transcript has a CDS region, a protein translation, and exons" ; rdfs:comment "Additionally the transcript might have one or more annotations" . affx:unigene a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The Unigene ID of the transcript - and splice variant" . affx:translatesTo a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "The amino acid sequence derived from the transcript" . affx:fullCds a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:GenomicCoordinates ; owl:cardinality "1" ; rdfs:comment "Start and stop coordinates of the full CDS region" . affx:hasExon a owl:ObjectProperty ; owl:domain affx:Transcript ; owl:range affx:ExonPlusCds ; owl:minCardinality "1" ; rdfs:comment "Here, exons are defined only by their coordinates " . affx:ExonPlusCds a owl:Class ; owl:hasProperty affx:relatesToExon ; owl:hasProperty affx:cdsType ; owl:hasProperty affx:cdsStart ; owl:hasProperty affx:cdsStop ; owl:hasProperty affx:frame . affx:relatesToExon a owl:ObjectProperty ; owl:domain affx:ExonWithCds ; owl:range affx:Exon ; owl:cardinality "1" ; rdfs:comment "For associating exons with properties such as frame" . affx:Exon a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:commonToAll ; rdfs:comment "Defines the coordinates of an exon on the genome" . affx:GenomicSpan a owl:Class ; rdfs:subClassOf affx:GenomicCoordinates ; rdfs:comment "This defines a region of _ungapped_ genomic alignment" . affx:GenomicCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Start and stop, possibly with intervening gaps " ; rdfs:comment "Strand and chr will be specified at the gene level " . affx:Coordinates a owl:Class ; owl:hasProperty affx:startsAt ; owl:hasProperty affx:stopsAt . affx:startsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:stopsAt a owl:ObjectProperty ; owl:cardinality "1" ; owl:range rdfs:Literal . affx:cdsType a owl:ObjectProperty ; owl:domain affx:ExonPlusCds ; owl:range rdfs:Literal ; rdfs:comment "Expected CDS types are Full, Partial, and None" . affx:commonToAll a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Shows if all the gene's variants share this object" . affx:CdsOccupancy a owl:Class ; rdfs:subClassOf rdfs:Literal . affx:cdsStart a owl:ObjectProperty ; rdfs:subClassOf affx:startsAt ; rdfs:comment "For indicating where a specific CDS region starts" . affx:cdsStop a owl:ObjectProperty ; rdfs:subClassOf affx:stopsAt ; rdfs:comment "For indicating where a specific CDS region stops" . affx:frame a owl:ObjectProperty ; owl:range rdfs:Literal ; owl:cardinality "1" . affx:signalPHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:SignalPeptide ; owl:cardinality "1" . affx:SignalPeptide a owl:Class ; rdfs:subClassOf affx:Annotation ; rdfs:comment "Represents a SIGNALP hit" . affx:tmHMMHit a owl:ObjectProperty ; rdfs:domain affx:Transcript ; rdfs:range affx:Transmembrane ; owl:cardinality "1" . affx:Transmembrane a owl:Class ; rdfs:subClassOf affx:Annotation ; owl:hasProperty affx:helixCount ; rdfs:comment "Represents a TMHMM hit" . affx:Annotation a owl:Class ; owl:hasProperty affx:containsMotif; owl:hasProperty affx:commonToAll ; owl:hasProperty affx:motifCount . affx:containsMotif a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range affx:Motif ; owl:minCardinality "1" . affx:motifCount a owl:ObjectProperty ; owl:domain affx:Annotation ; owl:range rdfs:Literal ; owl:cardinality "1" ; rdfs:comment "Number of motifs (eg. TM passes) in this annotation" . affx:Motif a owl:Class ; owl:hasProperty affx:hasProteinSpan . affx:hasProteinSpan a owl:ObjectProperty ; owl:domain affx:Motif ; owl:range affx:ProteinSpan . affx:ProteinCoordinates a owl:Class ; rdfs:subClassOf affx:Coordinates ; rdfs:comment "Coordinates onto the protein sequence, possibly gapped ". affx:spannedBy a owl:ObjectProperty ; owl:domain affx:ProteinSpan ; owl:range affx:CdsSpan ; owl:minCardinality "1" . affx:ProteinSpan a owl:Class ; rdfs:subClassOf affx:ProteinCoordinates ; owl:hasProperty affx:spannedBy ; rdfs:comment "An ungapped region of the protein sequence " ; rdfs:comment "Each ProteinSpan as one or more corresponding CDS span" . affx:CdsSpan a owl:Class ; rdfs:subClassOf affx:GenomicSpan ; owl:hasProperty affx:inFrame ; rdfs:comment "A CDS span is a genomic span with a translation frame" ; rdfs:comment "Each CDS span describes a part of the full CDS region" . :Il6 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13624310] . :gi13624310 a affx:Transcript ; affx:unigene "iMm.1019" ; affx:translatesTo "MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT" ; affx:hasCds [affx:startsAt "28513529" ; affx:stopsAt "28519890" ]; affx:hasExon [ affx:relatesToExon :Il6_e1; affx:cdsType "Partial" ; affx:cdsStart "28513529" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Il6_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Il6_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Il6_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Il6_e5; affx:cdsType "Partial" ; affx:cdsStop "28519890" ; affx:frame "1"] ; . :Il6_e1 a affx:Exon ; affx:startsAt "28513498" ; affx:stopsAt "28513548" ; affx:commonToAll "1" . :Il6_e2 a affx:Exon ; affx:startsAt "28513713" ; affx:stopsAt "28513898" ; affx:commonToAll "1" . :Il6_e3 a affx:Exon ; affx:startsAt "28515170" ; affx:stopsAt "28515284" ; affx:commonToAll "1" . :Il6_e4 a affx:Exon ; affx:startsAt "28518346" ; affx:stopsAt "28518496" ; affx:commonToAll "1" . :Il6_e5 a affx:Exon ; affx:startsAt "28519722" ; affx:stopsAt "28520310" ; affx:commonToAll "1" . :lunatic-fringe a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi2454569] . :gi2454569 a affx:Transcript ; affx:unigene "iMm.12834" ; affx:translatesTo "MLQRCGRRLLLALVGALLACLLVLTADPPPTPMPAERGRRALRSLAGSSGGAPASGSRAAVDPGVLTREVHSLSEYFSLLTRARRDADPPPGVASRQGDGHPRPPAEVLSPRDVFIAVKTTRKFHRARLDLLFETWISRHKEMTFIFTDGEDEALAKLTGNVVLTNCSSAHSRQALSCKMAVEYDRFIESGKKWFCHVDDDNYVNLRALLRLLASYPHTQDVYIGKPSLDRPIQATERISEHKVRPVHFWFATGGAGFCISRGLALKMGPWASGGHFMSTAERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTTELHEQVTLSYGMFENKRNAVHIKGPFSVEADPSRFRSVHCHLYPDTPWCPRSAIF" ; affx:hasCds [affx:startsAt "139509034" ; affx:stopsAt "139516092" ]; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e1; affx:cdsType "Partial" ; affx:cdsStart "139509034" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :lunatic-fringe_e8; affx:cdsType "Partial" ; affx:cdsStop "139516092" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "26" ; affx:spannedBy [ affx:startsAt "139509034" ; affx:stopsAt "139509112" ; affx:inFrame "0" ] ; ] ; ] ; . :lunatic-fringe_e1 a affx:Exon ; affx:startsAt "139508980" ; affx:stopsAt "139509463" ; affx:commonToAll "1" . :lunatic-fringe_e2 a affx:Exon ; affx:startsAt "139513468" ; affx:stopsAt "139513517" ; affx:commonToAll "1" . :lunatic-fringe_e3 a affx:Exon ; affx:startsAt "139513909" ; affx:stopsAt "139514009" ; affx:commonToAll "1" . :lunatic-fringe_e4 a affx:Exon ; affx:startsAt "139514121" ; affx:stopsAt "139514275" ; affx:commonToAll "1" . :lunatic-fringe_e5 a affx:Exon ; affx:startsAt "139514378" ; affx:stopsAt "139514464" ; affx:commonToAll "1" . :lunatic-fringe_e6 a affx:Exon ; affx:startsAt "139514774" ; affx:stopsAt "139514940" ; affx:commonToAll "1" . :lunatic-fringe_e7 a affx:Exon ; affx:startsAt "139515809" ; affx:stopsAt "139515895" ; affx:commonToAll "1" . :lunatic-fringe_e8 a affx:Exon ; affx:startsAt "139516025" ; affx:stopsAt "139516105" ; affx:commonToAll "1" . :Lhx5 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi1388182] . :gi1388182 a affx:Transcript ; affx:unigene "iMm.5151" ; affx:translatesTo "MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHGADNPRFTDMISHPDTPSPEPGLPGALHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW" ; affx:hasCds [affx:startsAt "118487751" ; affx:stopsAt "118496438" ]; affx:hasExon [ affx:relatesToExon :Lhx5_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Lhx5_e2; affx:cdsType "Partial" ; affx:cdsStart "118487751" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e6; affx:cdsType "Partial" ; affx:cdsStop "118496438" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Lhx5_e7; affx:cdsType "None" ] ; . :Lhx5_e1 a affx:Exon ; affx:startsAt "118487149" ; affx:stopsAt "118487308" ; affx:commonToAll "1" . :Lhx5_e2 a affx:Exon ; affx:startsAt "118487408" ; affx:stopsAt "118487924" ; affx:commonToAll "1" . :Lhx5_e3 a affx:Exon ; affx:startsAt "118490261" ; affx:stopsAt "118490485" ; affx:commonToAll "1" . :Lhx5_e4 a affx:Exon ; affx:startsAt "118491121" ; affx:stopsAt "118491399" ; affx:commonToAll "1" . :Lhx5_e5 a affx:Exon ; affx:startsAt "118492078" ; affx:stopsAt "118492244" ; affx:commonToAll "1" . :Lhx5_e6 a affx:Exon ; affx:startsAt "118496070" ; affx:stopsAt "118497335" ; affx:commonToAll "1" . :Lhx5_e7 a affx:Exon ; affx:startsAt "118497494" ; affx:stopsAt "118497508" ; affx:commonToAll "1" . :Gene4893 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi199100] . :gi199100 a affx:Transcript ; affx:unigene "iMm.6404" ; affx:translatesTo "MEFEENLKGRADKNFSKMGKKSKKEKKEKKPAVGVFGMFRYADWLDKLCMILGTLAAIIHGTLLPLLMLVFGNMTDSFTKAEASILPSITNQSGPNSTLIISNSSLEEEMAIYAYYYTGIGAGVLIVAYIQVSLWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINDGIGDKIGMFFQSITTFLAGFIIGFISGWKLTLVILAVSPLIGLSSALWAKVLTSFTNKELQAYAKAGAVAEEVLAAIRTVIAFGGQQKELERYNKNLEEAKNVGIKKAITASISIGIAYLLVYASYALAFWYGTSLVLSNEYSIGEVLTVFFSILLGTFSIGHLAPNIEAFANARGAAFEIFKIIDNEPSIDSFSTKGYKPDSIMGNLEFKNVHFNYPSRSEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTRGNEIEPGNNAYGSQSDTDASELTSEESKSPLIRRSIYRSVHRKQDQERRLSMKEAVDEDVPLVSFWRILNLNLSEWPYLLVGVLCAVINGCIQPVFAIVFSRIVGVFSRDDDHETKRQNCNLFSLFFLVMGLISFVTYFFQGFTFGKAGEILTKRVRYMVFKSMLRQDISWFDDHKNSTGSLTTRLASDASSVKGAMGARLAVVTQNVANLGTGVILSLVYGWQLTLLLVVIIPLIVLGGIIEMKLLSGQALKDKKQLEISGKIATEAIENFRTIVSLTREQKFETMYAQSLQVPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAQQLMTFENVMLVFSAVVFGAMAAGNTSSFAPDYAKAKVSASHIIRIIEKTPEIDSYSTEGLKPTLLEGNVKFNGVQFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRAVSHEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMVQAGAKRS" ; affx:hasCds [affx:startsAt "5001909" ; affx:stopsAt "5069177" ]; affx:hasExon [ affx:relatesToExon :Gene4893_e1; affx:cdsType "Partial" ; affx:cdsStart "5001909" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e12; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e19; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e21; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e22; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e23; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e24; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e25; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e26; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e27; affx:cdsType "Partial" ; affx:cdsStop "5069177" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4893_e28; affx:cdsType "None" ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "8" ; affx:containsMotif [ affx:startsAt "48" ; affx:stopsAt "70" ; affx:spannedBy [ affx:startsAt "5061815" ; affx:stopsAt "5061881" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "115" ; affx:stopsAt "137" ; affx:spannedBy [ affx:startsAt "5055188" ; affx:stopsAt "5055254" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "189" ; affx:stopsAt "211" ; affx:spannedBy [ affx:startsAt "5054239" ; affx:stopsAt "5054305" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "294" ; affx:stopsAt "316" ; affx:spannedBy [ affx:startsAt "5046523" ; affx:stopsAt "5046589" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "708" ; affx:stopsAt "730" ; affx:spannedBy [ affx:startsAt "5040083" ; affx:stopsAt "5040149" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "751" ; affx:stopsAt "773" ; affx:spannedBy [ affx:startsAt "5038987" ; affx:stopsAt "5039047" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "5035718" ; affx:stopsAt "5035724" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "850" ; affx:stopsAt "872" ; affx:spannedBy [ affx:startsAt "5030186" ; affx:stopsAt "5030252" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "935" ; affx:stopsAt "957" ; affx:spannedBy [ affx:startsAt "5018312" ; affx:stopsAt "5018378" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4893_e1 a affx:Exon ; affx:startsAt "5001551" ; affx:stopsAt "5002110" ; affx:commonToAll "1" . :Gene4893_e2 a affx:Exon ; affx:startsAt "5003598" ; affx:stopsAt "5003745" ; affx:commonToAll "1" . :Gene4893_e3 a affx:Exon ; affx:startsAt "5006229" ; affx:stopsAt "5006436" ; affx:commonToAll "1" . :Gene4893_e4 a affx:Exon ; affx:startsAt "5014288" ; affx:stopsAt "5014486" ; affx:commonToAll "1" . :Gene4893_e5 a affx:Exon ; affx:startsAt "5016301" ; affx:stopsAt "5016458" ; affx:commonToAll "1" . :Gene4893_e6 a affx:Exon ; affx:startsAt "5018262" ; affx:stopsAt "5018403" ; affx:commonToAll "1" . :Gene4893_e7 a affx:Exon ; affx:startsAt "5022066" ; affx:stopsAt "5022167" ; affx:commonToAll "1" . :Gene4893_e8 a affx:Exon ; affx:startsAt "5030123" ; affx:stopsAt "5030327" ; affx:commonToAll "1" . :Gene4893_e9 a affx:Exon ; affx:startsAt "5032806" ; affx:stopsAt "5032890" ; affx:commonToAll "1" . :Gene4893_e10 a affx:Exon ; affx:startsAt "5035646" ; affx:stopsAt "5035724" ; affx:commonToAll "1" . :Gene4893_e11 a affx:Exon ; affx:startsAt "5038987" ; affx:stopsAt "5039095" ; affx:commonToAll "1" . :Gene4893_e12 a affx:Exon ; affx:startsAt "5040068" ; affx:stopsAt "5040215" ; affx:commonToAll "1" . :Gene4893_e13 a affx:Exon ; affx:startsAt "5040418" ; affx:stopsAt "5040592" ; affx:commonToAll "1" . :Gene4893_e14 a affx:Exon ; affx:startsAt "5042205" ; affx:stopsAt "5042367" ; affx:commonToAll "1" . :Gene4893_e15 a affx:Exon ; affx:startsAt "5042634" ; affx:stopsAt "5042805" ; affx:commonToAll "1" . :Gene4893_e16 a affx:Exon ; affx:startsAt "5043026" ; affx:stopsAt "5043230" ; affx:commonToAll "1" . :Gene4893_e17 a affx:Exon ; affx:startsAt "5043320" ; affx:stopsAt "5043446" ; affx:commonToAll "1" . :Gene4893_e18 a affx:Exon ; affx:startsAt "5043621" ; affx:stopsAt "5043732" ; affx:commonToAll "1" . :Gene4893_e19 a affx:Exon ; affx:startsAt "5043873" ; affx:stopsAt "5043987" ; affx:commonToAll "1" . :Gene4893_e20 a affx:Exon ; affx:startsAt "5046475" ; affx:stopsAt "5046647" ; affx:commonToAll "1" . :Gene4893_e21 a affx:Exon ; affx:startsAt "5053071" ; affx:stopsAt "5053196" ; affx:commonToAll "1" . :Gene4893_e22 a affx:Exon ; affx:startsAt "5054173" ; affx:stopsAt "5054345" ; affx:commonToAll "1" . :Gene4893_e23 a affx:Exon ; affx:startsAt "5055072" ; affx:stopsAt "5055264" ; affx:commonToAll "1" . :Gene4893_e24 a affx:Exon ; affx:startsAt "5057303" ; affx:stopsAt "5057361" ; affx:commonToAll "1" . :Gene4893_e25 a affx:Exon ; affx:startsAt "5061748" ; affx:stopsAt "5061911" ; affx:commonToAll "1" . :Gene4893_e26 a affx:Exon ; affx:startsAt "5062437" ; affx:stopsAt "5062486" ; affx:commonToAll "1" . :Gene4893_e27 a affx:Exon ; affx:startsAt "5069112" ; affx:stopsAt "5069183" ; affx:commonToAll "1" . :Gene4893_e28 a affx:Exon ; affx:startsAt "5069629" ; affx:stopsAt "5069733" ; affx:commonToAll "1" . :Gene4894 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi3869144] . :gi3869144 a affx:Transcript ; affx:unigene "iMm.20899" ; affx:translatesTo "MGRVSFSVRVSSVRRARCSCPGRCYLSCRVPPTTALRALNGLGCAGVPGETAGGAVGPGPLGTRGFLSGSKFQAPGSWKDCFGAPPAPDVLRADRSVGEGCPQKLVTANLLRFLLLVLIPCICALIVLLAILLSFVGTLKRVYFKSNDSEPLVTDGEARVPGVIPVNTVYYENTGAPSLPPSQSTPAWTPRAPSPEDQSHRNTSTCMNITHSQCQILPYHSTLAPLLPIVKNMDMEKFLKFFTYLHRLSCYQHILLFGCSLAFPECVVDGDDRHGLLPCRSFCEAAKEGCESVLGMVNSSWPDSLRCSQFRDHTETNSSVRKSCFSLQQEHGKQSLCGGGESFLCTSGLCVPKKLQCNGYNDCDDWSDEAHCNCSKDLFHCGTGKCLHYSLLCDGYDDCGDLSDEQNCDCNLTKEHRCGDGRCIAAEWVCDGDHDCVDKSDEVNCSCHSQGLVECRSGQCIPSTFQCDGDEDCKDGSDEENCSDSQTPCPEGEQGCLGSSCVESCAGSSLCDSDSSLSNCSQCEPITLELCMNLPYNHTHYPNYLGHRTQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTGQRIPPCRLLCEHSKERCESVLGIVGLQWPEDTDCNQFPEESSDNQTCLLPNEDVEECSPSHFKCRSGRCVLGSRRCDGQADCDDDSDEENCGCKERALWECPFNKQCLKHTLICDGFPDCPDSMDEKNCSFCQDNELECANHECVPRDLWCDGWVDCSDSSDEWGCVTLSKNGNSSSLLTVHKSAKEHHVCADGWRETLSQLACKQMGLGEPSVTKLIPGQEGQQWLRLYPNWENLNGSTLQELLVYRHSCPSRSEISLLCSKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGREDADVWKVVFGINNLDHPSGFMQTRFVKTILLHPRYSRAVVDYDISVVELSDDINETSYVRPVCLPSPEEYLEPDTYCYITGWGHMGNKMPFKLQEGEVRIIPLEQCQSYFDMKTITNRMICAGYESGTVDSCMGDSGGPLVCERPGGQWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVGWIERQIYIQTFLQKKSQG" ; affx:hasCds [affx:startsAt "71411403" ; affx:stopsAt "71615121" ]; affx:hasExon [ affx:relatesToExon :Gene4894_e1; affx:cdsType "Partial" ; affx:cdsStart "71411403" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e21; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4894_e22; affx:cdsType "Partial" ; affx:cdsStop "71615121" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "113" ; affx:stopsAt "135" ; affx:spannedBy [ affx:startsAt "71582812" ; affx:stopsAt "71582878" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene4894_e1 a affx:Exon ; affx:startsAt "71409943" ; affx:stopsAt "71411598" ; affx:commonToAll "1" . :Gene4894_e2 a affx:Exon ; affx:startsAt "71412708" ; affx:stopsAt "71412842" ; affx:commonToAll "1" . :Gene4894_e3 a affx:Exon ; affx:startsAt "71414792" ; affx:stopsAt "71415064" ; affx:commonToAll "1" . :Gene4894_e4 a affx:Exon ; affx:startsAt "71425941" ; affx:stopsAt "71426116" ; affx:commonToAll "1" . :Gene4894_e5 a affx:Exon ; affx:startsAt "71426259" ; affx:stopsAt "71426309" ; affx:commonToAll "1" . :Gene4894_e6 a affx:Exon ; affx:startsAt "71429439" ; affx:stopsAt "71429553" ; affx:commonToAll "1" . :Gene4894_e7 a affx:Exon ; affx:startsAt "71439530" ; affx:stopsAt "71439660" ; affx:commonToAll "1" . :Gene4894_e8 a affx:Exon ; affx:startsAt "71440729" ; affx:stopsAt "71440840" ; affx:commonToAll "1" . :Gene4894_e9 a affx:Exon ; affx:startsAt "71442683" ; affx:stopsAt "71442797" ; affx:commonToAll "1" . :Gene4894_e10 a affx:Exon ; affx:startsAt "71448976" ; affx:stopsAt "71449084" ; affx:commonToAll "1" . :Gene4894_e11 a affx:Exon ; affx:startsAt "71449856" ; affx:stopsAt "71450002" ; affx:commonToAll "1" . :Gene4894_e12 a affx:Exon ; affx:startsAt "71452901" ; affx:stopsAt "71453133" ; affx:commonToAll "1" . :Gene4894_e13 a affx:Exon ; affx:startsAt "71463886" ; affx:stopsAt "71463994" ; affx:commonToAll "1" . :Gene4894_e14 a affx:Exon ; affx:startsAt "71466892" ; affx:stopsAt "71467009" ; affx:commonToAll "1" . :Gene4894_e15 a affx:Exon ; affx:startsAt "71468390" ; affx:stopsAt "71468501" ; affx:commonToAll "1" . :Gene4894_e16 a affx:Exon ; affx:startsAt "71470667" ; affx:stopsAt "71470775" ; affx:commonToAll "1" . :Gene4894_e17 a affx:Exon ; affx:startsAt "71482116" ; affx:stopsAt "71482230" ; affx:commonToAll "1" . :Gene4894_e18 a affx:Exon ; affx:startsAt "71532557" ; affx:stopsAt "71532742" ; affx:commonToAll "1" . :Gene4894_e19 a affx:Exon ; affx:startsAt "71545767" ; affx:stopsAt "71545975" ; affx:commonToAll "1" . :Gene4894_e20 a affx:Exon ; affx:startsAt "71564839" ; affx:stopsAt "71565040" ; affx:commonToAll "1" . :Gene4894_e21 a affx:Exon ; affx:startsAt "71582808" ; affx:stopsAt "71582950" ; affx:commonToAll "1" . :Gene4894_e22 a affx:Exon ; affx:startsAt "71614854" ; affx:stopsAt "71615181" ; affx:commonToAll "1" . :Gene4895 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15488725] . :gi15488725 a affx:Transcript ; affx:unigene "iMm.80532" ; affx:translatesTo "MEYPYTTKMLSSSLSPQNGTWSDTISLLLALGVALYLGYYWACVPQRPRLVAGPQFLAFLEQHCPVTVETFYPTLWCFEGRLQTIFRVLLQSQPVVPYRSEVLQTPDGGQFLLDWAEQPNSTHYPDPTTQPIVLLLPGISGSSQEPYILHLVNQALKDGYRAVVFNNRGCRGEELLTHRAYCASNTEDLETVVKHIKRRYSQAPLLAVGISFGGILVLNYLAQTGKAGGLVAGLTMSACWDSFETVDSLETPLNSLLFNQPLTAGLCRLVARNRKPIEKVLDVDFAIKARTIRQLDERYTSVAFGYKDCAAYYQAASPRTKVDAIHTPVLCLNAADDPFSPVHAFPLQAAQKSPYVALLITARGGHIGFLEGLMPWQHCYMNRVLHQYARAIFQHSVGLPDLGVLTPEDGKS" ; affx:hasCds [affx:startsAt "29611715" ; affx:stopsAt "29616629" ]; affx:hasExon [ affx:relatesToExon :Gene4895_e1; affx:cdsType "Partial" ; affx:cdsStart "29611715" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e6; affx:cdsType "Partial" ; affx:cdsStop "29615761" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4895_e9; affx:cdsType "Partial" ; affx:cdsStop "29616629" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "20" ; affx:stopsAt "42" ; affx:spannedBy [ affx:startsAt "29611775" ; affx:stopsAt "29611841" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4895_e1 a affx:Exon ; affx:startsAt "29611710" ; affx:stopsAt "29611853" ; affx:commonToAll "1" . :Gene4895_e2 a affx:Exon ; affx:startsAt "29614489" ; affx:stopsAt "29614650" ; affx:commonToAll "1" . :Gene4895_e3 a affx:Exon ; affx:startsAt "29614947" ; affx:stopsAt "29615130" ; affx:commonToAll "1" . :Gene4895_e4 a affx:Exon ; affx:startsAt "29615271" ; affx:stopsAt "29615317" ; affx:commonToAll "1" . :Gene4895_e5 a affx:Exon ; affx:startsAt "29615483" ; affx:stopsAt "29615596" ; affx:commonToAll "1" . :Gene4895_e6 a affx:Exon ; affx:startsAt "29615695" ; affx:stopsAt "29615870" ; affx:commonToAll "1" . :Gene4895_e7 a affx:Exon ; affx:startsAt "29616009" ; affx:stopsAt "29616058" ; affx:commonToAll "1" . :Gene4895_e8 a affx:Exon ; affx:startsAt "29616138" ; affx:stopsAt "29616304" ; affx:commonToAll "1" . :Gene4895_e9 a affx:Exon ; affx:startsAt "29616420" ; affx:stopsAt "29616696" ; affx:commonToAll "1" . :Gene4896 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi3149958] . :gi3149958 a affx:Transcript ; affx:unigene "iMm.10080" ; affx:translatesTo "MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQLELRARYNLSEGGYEELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIGFVSCISTLCIGAAAFSYYERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNLVVLRFMTMNAEDEKRDAEHRALLTHNGQAVGLGGLSCLSGSLGDGVRPRDPVTCAAAAGGVGVGVGGSGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEHSHSSPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLAAFRGLMKRRSSV" ; affx:hasCds [affx:startsAt "29246866" ; affx:stopsAt "29282253" ]; affx:hasExon [ affx:relatesToExon :Gene4896_e1; affx:cdsType "Partial" ; affx:cdsStart "29246866" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4896_e2; affx:cdsType "Partial" ; affx:cdsStop "29282253" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "23" ; affx:spannedBy [ affx:startsAt "29246866" ; affx:stopsAt "29246935" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "5" ; affx:containsMotif [ affx:startsAt "75" ; affx:stopsAt "97" ; affx:spannedBy [ affx:startsAt "29247091" ; affx:stopsAt "29247149" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "29281306" ; affx:stopsAt "29281314" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "109" ; affx:stopsAt "128" ; affx:spannedBy [ affx:startsAt "29281350" ; affx:stopsAt "29281407" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "159" ; affx:stopsAt "181" ; affx:spannedBy [ affx:startsAt "29281500" ; affx:stopsAt "29281566" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "186" ; affx:stopsAt "208" ; affx:spannedBy [ affx:startsAt "29281581" ; affx:stopsAt "29281647" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "221" ; affx:stopsAt "243" ; affx:spannedBy [ affx:startsAt "29281686" ; affx:stopsAt "29281752" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4896_e1 a affx:Exon ; affx:startsAt "29246731" ; affx:stopsAt "29247149" ; affx:commonToAll "1" . :Gene4896_e2 a affx:Exon ; affx:startsAt "29281306" ; affx:stopsAt "29282897" ; affx:commonToAll "1" . :Gene4897 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi3387819] . :gi3387819 a affx:Transcript ; affx:unigene "iMm.200775" ; affx:translatesTo "MAVTSHHMVPVFVLMSACLATAGPEPSTRCELSPISASHPVQALMESFTVLSGCASRGTTGLPREVHILNLRSTDQGLGQPQREVTLHLNPIASVHTHHKPVVFLLNSPQPLVWHVKTERLAAGVPRLFLVSEGSVVQFSSGNFSLTAETEERSFPQENEHLLHWAQKEYGAVTSFTELKIARNIYIKVGEDQVFPPTCNIGKNFLSLNYLAEYLQPKAAEGCVLASQPHEKEVHIIELISPNSNPYSTFQVDIIIDIRPAREDPEVVKNLVLILKCKKSVNWVIKSFDVKGNLKVIAPDSIGFGKESERSMTVTKLVRNDIPSTQENLMKWALDNGYSPVTSYTIAPVANRFHLRLENNEEMRDEEVHTIPPELRILLGPDHLPALDSPSFQGEIPNGGFPFPFPDIPRRGWKEGEDRIPRPKEPIIPRVQLLPDHREPEEVQGGVNIALSVKCDNEKMVVAVDKDSFQTNGYSGMELTLLDPSCKAKMNGTHFVLESPLNGCGTRHRRSAPDGVVYYNSIVVQAPSPGDSSGWPDGYEDLESGDNGFPGDTDEGETAPLSRAGVVVFNCSLRQLRSPSGFQDQLDGNATFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFISPYSNPDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFVFKSVFNTSLLFLHCELTLCSRKKGSQKLPKCVTPDDACTSLDATMIWTMMQNKKTFTKPLAVVLQVDYKENVPNMKESSPVPPPPQIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETARRQQVPTSPPASENSSAAHSIGSTQSTPCSSSSTA" ; affx:hasCds [affx:startsAt "104777216" ; affx:stopsAt "104940056" ]; affx:hasExon [ affx:relatesToExon :Gene4897_e1; affx:cdsType "Partial" ; affx:cdsStart "104777216" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4897_e16; affx:cdsType "Partial" ; affx:cdsStop "104940056" ; affx:frame "0"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "22" ; affx:spannedBy [ affx:startsAt "104939990" ; affx:stopsAt "104940056" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "786" ; affx:stopsAt "808" ; affx:spannedBy [ affx:startsAt "104785887" ; affx:stopsAt "104785953" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4897_e1 a affx:Exon ; affx:startsAt "104776043" ; affx:stopsAt "104777335" ; affx:commonToAll "1" . :Gene4897_e2 a affx:Exon ; affx:startsAt "104785877" ; affx:stopsAt "104785985" ; affx:commonToAll "1" . :Gene4897_e3 a affx:Exon ; affx:startsAt "104788818" ; affx:stopsAt "104788866" ; affx:commonToAll "1" . :Gene4897_e4 a affx:Exon ; affx:startsAt "104797944" ; affx:stopsAt "104798062" ; affx:commonToAll "1" . :Gene4897_e5 a affx:Exon ; affx:startsAt "104800216" ; affx:stopsAt "104800513" ; affx:commonToAll "1" . :Gene4897_e6 a affx:Exon ; affx:startsAt "104804401" ; affx:stopsAt "104804560" ; affx:commonToAll "1" . :Gene4897_e7 a affx:Exon ; affx:startsAt "104805012" ; affx:stopsAt "104805153" ; affx:commonToAll "1" . :Gene4897_e8 a affx:Exon ; affx:startsAt "104807251" ; affx:stopsAt "104807404" ; affx:commonToAll "1" . :Gene4897_e9 a affx:Exon ; affx:startsAt "104807866" ; affx:stopsAt "104808195" ; affx:commonToAll "1" . :Gene4897_e10 a affx:Exon ; affx:startsAt "104809839" ; affx:stopsAt "104810029" ; affx:commonToAll "1" . :Gene4897_e11 a affx:Exon ; affx:startsAt "104815387" ; affx:stopsAt "104815535" ; affx:commonToAll "1" . :Gene4897_e12 a affx:Exon ; affx:startsAt "104817622" ; affx:stopsAt "104817791" ; affx:commonToAll "1" . :Gene4897_e13 a affx:Exon ; affx:startsAt "104822084" ; affx:stopsAt "104822268" ; affx:commonToAll "1" . :Gene4897_e14 a affx:Exon ; affx:startsAt "104850004" ; affx:stopsAt "104850142" ; affx:commonToAll "1" . :Gene4897_e15 a affx:Exon ; affx:startsAt "104888284" ; affx:stopsAt "104888469" ; affx:commonToAll "1" . :Gene4897_e16 a affx:Exon ; affx:startsAt "104939989" ; affx:stopsAt "104940148" ; affx:commonToAll "1" . :HCG-1 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi4105255] . :gi4105255 a affx:Transcript ; affx:unigene "iMm.21846" ; affx:translatesTo "MSSHVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNTCRTVASTSVGLNHS" ; affx:hasCds [affx:startsAt "147459861" ; affx:stopsAt "147506582" ]; affx:hasExon [ affx:relatesToExon :HCG-1_e1; affx:cdsType "Partial" ; affx:cdsStart "147459861" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HCG-1_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HCG-1_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :HCG-1_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :HCG-1_e5; affx:cdsType "Partial" ; affx:cdsStop "147506582" ; affx:frame "2"] ; . :HCG-1_e1 a affx:Exon ; affx:startsAt "147458892" ; affx:stopsAt "147459910" ; affx:commonToAll "1" . :HCG-1_e2 a affx:Exon ; affx:startsAt "147460295" ; affx:stopsAt "147460365" ; affx:commonToAll "1" . :HCG-1_e3 a affx:Exon ; affx:startsAt "147463110" ; affx:stopsAt "147463197" ; affx:commonToAll "1" . :HCG-1_e4 a affx:Exon ; affx:startsAt "147465735" ; affx:stopsAt "147465844" ; affx:commonToAll "1" . :HCG-1_e5 a affx:Exon ; affx:startsAt "147506555" ; affx:stopsAt "147506631" ; affx:commonToAll "1" . :Gene4899 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi2661089] . :gi2661089 a affx:Transcript ; affx:unigene "iMm.6259" ; affx:translatesTo "MRFGGSTRLFILQGPEEDREAESELTVTQLKELRKQQQILLEKKMLGEDSDEEEEANTTEGKSSRSGQDDELGCTWGMGEDAVEDEAEENPIALDFQQDREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKKKEAMVQCSLEACRVLDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLVEKKRLNRMKKAGKLDEKPETFESLVAKLNDAERELAEISERLKASSKVLSEPSSQDSLDAFMSEMKSGSTLDGVSRKKLHLRTFELRKEQQRLKGLIKLVKPAEIPELKKTELQTTNAENKTKKLALPLFGAMKGGSKFKLKTGTVGKLPPKRPELPPALMQMKDEPEVEEEEEEEEEEEEKVKEEHEERVEDGGVRLLQEPELELEAAVEHPSAPSEPSCSKETKSHAAPANEYKQDRDEPKKKKSPGPGKFPPILSSKYPEDDPDYCIWVPPEGQSGDGRTHLNDKYGY" ; affx:hasCds [affx:startsAt "30197108" ; affx:stopsAt "30223151" ]; affx:hasExon [ affx:relatesToExon :Gene4899_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4899_e2; affx:cdsType "Partial" ; affx:cdsStart "30197108" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4899_e14; affx:cdsType "Partial" ; affx:cdsStop "30223151" ; affx:frame "2"] ; . :Gene4899_e1 a affx:Exon ; affx:startsAt "30196485" ; affx:stopsAt "30196651" ; affx:commonToAll "1" . :Gene4899_e2 a affx:Exon ; affx:startsAt "30196773" ; affx:stopsAt "30197147" ; affx:commonToAll "1" . :Gene4899_e3 a affx:Exon ; affx:startsAt "30197505" ; affx:stopsAt "30197701" ; affx:commonToAll "1" . :Gene4899_e4 a affx:Exon ; affx:startsAt "30200143" ; affx:stopsAt "30200266" ; affx:commonToAll "1" . :Gene4899_e5 a affx:Exon ; affx:startsAt "30201483" ; affx:stopsAt "30201544" ; affx:commonToAll "1" . :Gene4899_e6 a affx:Exon ; affx:startsAt "30201954" ; affx:stopsAt "30202094" ; affx:commonToAll "1" . :Gene4899_e7 a affx:Exon ; affx:startsAt "30203555" ; affx:stopsAt "30203716" ; affx:commonToAll "1" . :Gene4899_e8 a affx:Exon ; affx:startsAt "30204368" ; affx:stopsAt "30204438" ; affx:commonToAll "1" . :Gene4899_e9 a affx:Exon ; affx:startsAt "30205648" ; affx:stopsAt "30205835" ; affx:commonToAll "1" . :Gene4899_e10 a affx:Exon ; affx:startsAt "30209896" ; affx:stopsAt "30210008" ; affx:commonToAll "1" . :Gene4899_e11 a affx:Exon ; affx:startsAt "30213180" ; affx:stopsAt "30213424" ; affx:commonToAll "1" . :Gene4899_e12 a affx:Exon ; affx:startsAt "30217973" ; affx:stopsAt "30218044" ; affx:commonToAll "1" . :Gene4899_e13 a affx:Exon ; affx:startsAt "30220075" ; affx:stopsAt "30220145" ; affx:commonToAll "1" . :Gene4899_e14 a affx:Exon ; affx:startsAt "30223101" ; affx:stopsAt "30223403" ; affx:commonToAll "1" . :oasl9 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18389328] . :gi18389328 a affx:Transcript ; affx:unigene "iMm.95479" ; affx:translatesTo "MAVAQELYGFPASKLDSFVAQWLQPTREWKEEVLETVQTVEQFLRQENFREDRGPARDVRVLKVLKVGCFGNGTVLRSTTDVELVVFLSCFHSFQEEAKHHQAVLRLIQKRMYYCQELMDLGLSNLSVTNRVPSSLIFTIQTRETWETITVTVVPAYRALGPSCPSSEVYANLIKANGYPGNFSPSFSELQRNFVKHRPTKLKSLLRLVKHWYQQYVRDKCPRANLPPLYALELLTVYAWEAGTREDANFRLDEGLATVMELLQDHELLCIYWTKHYTLQHPVIEACVRRQLRGQRPIILDPADPTNNVAEGYRWDIVAQRANQCLKQDCCYDNRDSPVPSWRVKRAPDIQVTVQEWGHSDLTFWVNPYEPIKKLKEKIQLSQGYLGLQRLSFQEPGGERQLIRSHCTLAYYGIFCDTHICLLDTISPEIQVFVKNPDGRSHAYAIHPLDYVLNLKQQIEDRQGLRCQEQRLEFQGHILEDWFDFKSYGIQDSVTVILSKTTEGAAPFVPS" ; affx:hasCds [affx:startsAt "112887506" ; affx:stopsAt "112901495" ]; affx:hasExon [ affx:relatesToExon :oasl9_e1; affx:cdsType "Partial" ; affx:cdsStart "112887506" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl9_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl9_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl9_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl9_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oasl9_e6; affx:cdsType "Partial" ; affx:cdsStop "112901495" ; affx:frame "2"] ; . :oasl9_e1 a affx:Exon ; affx:startsAt "112887500" ; affx:stopsAt "112887704" ; affx:commonToAll "1" . :oasl9_e2 a affx:Exon ; affx:startsAt "112892117" ; affx:stopsAt "112892400" ; affx:commonToAll "1" . :oasl9_e3 a affx:Exon ; affx:startsAt "112893916" ; affx:stopsAt "112894080" ; affx:commonToAll "1" . :oasl9_e4 a affx:Exon ; affx:startsAt "112896799" ; affx:stopsAt "112897041" ; affx:commonToAll "1" . :oasl9_e5 a affx:Exon ; affx:startsAt "112899997" ; affx:stopsAt "112900145" ; affx:commonToAll "1" . :oasl9_e6 a affx:Exon ; affx:startsAt "112900994" ; affx:stopsAt "112901989" ; affx:commonToAll "1" . :oasl11 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi18389332] . :gi18389332 a affx:Transcript ; affx:unigene "iMm.7703" ; affx:translatesTo "MGNWLTGNWSSDRSSGYSSGWSPGGSSGVPSGPVHKLEKSIQANLTPNENCLKQIAVSSVPSQKLEGYIQENLKPNRESLKQIDQAVDAIWDLLRSQIPVKEVAKGGSYGRETALRGCSDGTLVLFMDCFQQFQDQIKYQDAYLDVIELWLKIHEKKSVKHEHALVVQVSVPGQRILLQLLPVFNPLRSNENPSSCVYVDLKKSMDQVRASPGEFSDCFTTLQQRFFKKYPQRLKDLILLVKHWYEQCQEKWKTPPPQPLLYALELLTVYAWEQGCQAEDFDMAQGVRTVLRLIQRPTELCVYWTVNYNFEDETVRNILLHQLRSQRPVILDPTDPTNNVGKDDGFWELLTEEAMAWLYSPSLNTESPAPYWDVLPMPLFVTPSHLLNKFIKDFLQPNKLFLKQIKEAVDIICSFLKNVCFLNSDTKVLKTVKGGSTAKGTALKRGSDADIVVFLSSLESYDSLKTNRSQFVQEIQKQLEEFVQAQEWEVTFEISKWKAPRVLSFTLKSKTLNESVEFDVLPAYDALGQLRSDFTLRPEAYKDLIELCASQDIKEGEFSICFTELQRNFIQTRPTKLKSLLRLIKHWYKQYERKMKPKASLPPKYALELLTVYAWEQGSGTDDFDIAEGFRTVLDLVIKYRQLCIFWTVNYNFEEEYMRKFLLTQIQKKRPVILDPADPTGDVGGGDRWCWHLLAEEAKEWLSSPCFQVEQKGLVQPWKVPVMQTPGSCGGQIYPTVGGVTK" ; affx:hasCds [affx:startsAt "118789054" ; affx:stopsAt "118806762" ]; affx:hasExon [ affx:relatesToExon :oasl11_e1; affx:cdsType "Partial" ; affx:cdsStart "118789054" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl11_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oasl11_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oasl11_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl11_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl11_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl11_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl11_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :oasl11_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :oasl11_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :oasl11_e11; affx:cdsType "Partial" ; affx:cdsStop "118806762" ; affx:frame "2"] ; . :oasl11_e1 a affx:Exon ; affx:startsAt "118787494" ; affx:stopsAt "118789120" ; affx:commonToAll "1" . :oasl11_e2 a affx:Exon ; affx:startsAt "118790575" ; affx:stopsAt "118790729" ; affx:commonToAll "1" . :oasl11_e3 a affx:Exon ; affx:startsAt "118792141" ; affx:stopsAt "118792380" ; affx:commonToAll "1" . :oasl11_e4 a affx:Exon ; affx:startsAt "118793158" ; affx:stopsAt "118793346" ; affx:commonToAll "1" . :oasl11_e5 a affx:Exon ; affx:startsAt "118795240" ; affx:stopsAt "118795523" ; affx:commonToAll "1" . :oasl11_e6 a affx:Exon ; affx:startsAt "118795615" ; affx:stopsAt "118795789" ; affx:commonToAll "1" . :oasl11_e7 a affx:Exon ; affx:startsAt "118798140" ; affx:stopsAt "118798285" ; affx:commonToAll "1" . :oasl11_e8 a affx:Exon ; affx:startsAt "118800040" ; affx:stopsAt "118800279" ; affx:commonToAll "1" . :oasl11_e9 a affx:Exon ; affx:startsAt "118802672" ; affx:stopsAt "118802851" ; affx:commonToAll "1" . :oasl11_e10 a affx:Exon ; affx:startsAt "118805526" ; affx:stopsAt "118805773" ; affx:commonToAll "1" . :oasl11_e11 a affx:Exon ; affx:startsAt "118806447" ; affx:stopsAt "118806842" ; affx:commonToAll "1" . :Gene4902 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15281297] . :gi15281297 a affx:Transcript ; affx:unigene "iMm.41565" ; affx:translatesTo "MSKLARLEREEIMECQVMWEPDSKKDTQMDRFRAAVGTACGLALGNYNDLYHWSVRSYMDFWAEFWKFSGIVYSRMYDEVVDTSKGIADVPEWFRGSRLNYAENLLRHKENDRVALYVAREGREEIVKVTFEELRQQVALFAAAMRKMGVKKGDRVVGYLPNSAHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHGHLEKLQRVVKGLPDLQRVVLIPYVLPREKIDISKIPNSVFLDDFLASGTGAQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCMVHSAGGTLIQHLKEHMLHGNMTSSDILLYYTTVGWMMWNWMVSALATGASLVLYDGSPLVPTPNVLWDLVDRIGITILGTGAKWLSVLEEKDMKPVETHNLHTLHTILSTGSPLKAQSYEYVYRCIKSSVLLGSISGGTDIISCFMGQNSSIPVYKGEIQARNLGMAVEAWDEEGKAVWGASGELVCTKPIPCQPTHFWNDENGSKYRKAYFSKFPGVWAHGDYCRINPKTGGIIMLGRSDGTLNPNGVRFGSSEIYNIVEAFDEVEDSLCVPQYNRDGEERVVLFLKMASGHTFQPDLVKRIRDAIRLGLSARHVPSLILETRGIPYTLNGKKVEVAVKQVMAGRTVEHRGAFSNPETLDLYRDIPELQDF" ; affx:hasCds [affx:startsAt "123722546" ; affx:stopsAt "123762667" ]; affx:hasExon [ affx:relatesToExon :Gene4902_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e14; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e17; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4902_e18; affx:cdsType "Full" ; affx:frame "2"] ; . :Gene4902_e1 a affx:Exon ; affx:startsAt "123722546" ; affx:stopsAt "123722679" ; affx:commonToAll "1" . :Gene4902_e2 a affx:Exon ; affx:startsAt "123729399" ; affx:stopsAt "123729503" ; affx:commonToAll "1" . :Gene4902_e3 a affx:Exon ; affx:startsAt "123731253" ; affx:stopsAt "123731374" ; affx:commonToAll "1" . :Gene4902_e4 a affx:Exon ; affx:startsAt "123736502" ; affx:stopsAt "123736616" ; affx:commonToAll "1" . :Gene4902_e5 a affx:Exon ; affx:startsAt "123741627" ; affx:stopsAt "123741725" ; affx:commonToAll "1" . :Gene4902_e6 a affx:Exon ; affx:startsAt "123749555" ; affx:stopsAt "123749670" ; affx:commonToAll "1" . :Gene4902_e7 a affx:Exon ; affx:startsAt "123749921" ; affx:stopsAt "123750003" ; affx:commonToAll "1" . :Gene4902_e8 a affx:Exon ; affx:startsAt "123752521" ; affx:stopsAt "123752669" ; affx:commonToAll "1" . :Gene4902_e9 a affx:Exon ; affx:startsAt "123754990" ; affx:stopsAt "123755071" ; affx:commonToAll "1" . :Gene4902_e10 a affx:Exon ; affx:startsAt "123756092" ; affx:stopsAt "123756217" ; affx:commonToAll "1" . :Gene4902_e11 a affx:Exon ; affx:startsAt "123757953" ; affx:stopsAt "123758018" ; affx:commonToAll "1" . :Gene4902_e12 a affx:Exon ; affx:startsAt "123758159" ; affx:stopsAt "123758282" ; affx:commonToAll "1" . :Gene4902_e13 a affx:Exon ; affx:startsAt "123758938" ; affx:stopsAt "123759052" ; affx:commonToAll "1" . :Gene4902_e14 a affx:Exon ; affx:startsAt "123759415" ; affx:stopsAt "123759541" ; affx:commonToAll "1" . :Gene4902_e15 a affx:Exon ; affx:startsAt "123760232" ; affx:stopsAt "123760302" ; affx:commonToAll "1" . :Gene4902_e16 a affx:Exon ; affx:startsAt "123760482" ; affx:stopsAt "123760541" ; affx:commonToAll "1" . :Gene4902_e17 a affx:Exon ; affx:startsAt "123761241" ; affx:stopsAt "123761444" ; affx:commonToAll "1" . :Gene4902_e18 a affx:Exon ; affx:startsAt "123762529" ; affx:stopsAt "123762667" ; affx:commonToAll "1" . :NLP-1 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15054481] . :gi15054481 a affx:Transcript ; affx:unigene "iMm.45513" ; affx:translatesTo "MTICQFFLQGRCRFGDRCWNEHPGARGAGGARQPPPQQQPPSGNNRRGWNASSQRYSNVIQPSSFPKSTPWGGSRDQDKPPFGSFDSGASTSRGFGSSQNPFASPLSDEQKDEKKLLEGIVKDVEVWESSGQWMFSVYSPVRKKPNISAKLCSTACKSVEE" ; affx:hasCds [affx:startsAt "22622842" ; affx:stopsAt "22635789" ]; affx:hasExon [ affx:relatesToExon :NLP-1_e1; affx:cdsType "Partial" ; affx:cdsStart "22622842" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :NLP-1_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :NLP-1_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :NLP-1_e4; affx:cdsType "Partial" ; affx:cdsStop "22635789" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :NLP-1_e5; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :NLP-1_e6; affx:cdsType "None" ] ; . :NLP-1_e1 a affx:Exon ; affx:startsAt "22622803" ; affx:stopsAt "22622969" ; affx:commonToAll "1" . :NLP-1_e2 a affx:Exon ; affx:startsAt "22625108" ; affx:stopsAt "22625331" ; affx:commonToAll "1" . :NLP-1_e3 a affx:Exon ; affx:startsAt "22627061" ; affx:stopsAt "22627156" ; affx:commonToAll "1" . :NLP-1_e4 a affx:Exon ; affx:startsAt "22635748" ; affx:stopsAt "22635835" ; affx:commonToAll "1" . :NLP-1_e5 a affx:Exon ; affx:startsAt "22638829" ; affx:stopsAt "22638914" ; affx:commonToAll "1" . :NLP-1_e6 a affx:Exon ; affx:startsAt "22639656" ; affx:stopsAt "22640586" ; affx:commonToAll "1" . :Gene4904 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi7619895] . :gi7619895 a affx:Transcript ; affx:unigene "iMm.29430" ; affx:translatesTo "MAHVGSRKRSRSRSRSRSGRRGSEKRSKRSSKDASRNCSASRSQGHKAGSASGVEERSKHKAQRTSRSSSTSSSSSSSSSASSSSSSDGRKKRAKHKEKKRKKKKKKRKKKLKKRVKEKAVAVHQAEALPGPSLDQWHRSAGEDNDGPVLTDEQKSRIQAMKPMTKEEWDARQSVIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDGLAFQMRTGLLP" ; affx:hasCds [affx:startsAt "122217228" ; affx:stopsAt "122218824" ]; affx:hasExon [ affx:relatesToExon :Gene4904_e1; affx:cdsType "Partial" ; affx:cdsStart "122217228" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4904_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4904_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4904_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4904_e5; affx:cdsType "Partial" ; affx:cdsStop "122218824" ; affx:frame "1"] ; . :Gene4904_e1 a affx:Exon ; affx:startsAt "122216890" ; affx:stopsAt "122217394" ; affx:commonToAll "1" . :Gene4904_e2 a affx:Exon ; affx:startsAt "122217697" ; affx:stopsAt "122217976" ; affx:commonToAll "1" . :Gene4904_e3 a affx:Exon ; affx:startsAt "122218053" ; affx:stopsAt "122218171" ; affx:commonToAll "1" . :Gene4904_e4 a affx:Exon ; affx:startsAt "122218612" ; affx:stopsAt "122218682" ; affx:commonToAll "1" . :Gene4904_e5 a affx:Exon ; affx:startsAt "122218767" ; affx:stopsAt "122218978" ; affx:commonToAll "1" . :Tbx5 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi6002731] . :gi6002731 a affx:Transcript ; affx:unigene "iMm.103636" ; affx:translatesTo "MADTDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDLELHRMSRMQSKEYPVVPRSTVRHKVTSNHSPFSSETRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLAQEHSQIYHCTKRKDEECSSTEHPYKKPYMETSPSEEDTFYRSGYPQQQGLSTSYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGGLQPPEFLYTHGVPRTLSPHQYHSVHGVGMVPEWSENS" ; affx:hasCds [affx:startsAt "117883579" ; affx:stopsAt "117931364" ]; affx:hasExon [ affx:relatesToExon :Tbx5_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Tbx5_e2; affx:cdsType "Partial" ; affx:cdsStart "117883579" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Tbx5_e9; affx:cdsType "Partial" ; affx:cdsStop "117931364" ; affx:frame "0"] ; . :Tbx5_e1 a affx:Exon ; affx:startsAt "117881568" ; affx:stopsAt "117881943" ; affx:commonToAll "1" . :Tbx5_e2 a affx:Exon ; affx:startsAt "117883541" ; affx:stopsAt "117883726" ; affx:commonToAll "1" . :Tbx5_e3 a affx:Exon ; affx:startsAt "117885361" ; affx:stopsAt "117885456" ; affx:commonToAll "1" . :Tbx5_e4 a affx:Exon ; affx:startsAt "117887432" ; affx:stopsAt "117887552" ; affx:commonToAll "1" . :Tbx5_e5 a affx:Exon ; affx:startsAt "117888418" ; affx:stopsAt "117888566" ; affx:commonToAll "1" . :Tbx5_e6 a affx:Exon ; affx:startsAt "117891630" ; affx:stopsAt "117891783" ; affx:commonToAll "1" . :Tbx5_e7 a affx:Exon ; affx:startsAt "117900359" ; affx:stopsAt "117900451" ; affx:commonToAll "1" . :Tbx5_e8 a affx:Exon ; affx:startsAt "117918708" ; affx:stopsAt "117918935" ; affx:commonToAll "1" . :Tbx5_e9 a affx:Exon ; affx:startsAt "117930789" ; affx:stopsAt "117931379" ; affx:commonToAll "1" . :Slit2 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi5532494] . :gi5532494 a affx:Transcript ; affx:unigene "iMm.34584" ; affx:translatesTo "MSGIGWQTLSLSLGLVLSILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRHLRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNSIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTVAPGAFDSLHSLSTLNLLANPFNCNCHLAWLGEWLRRKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPSECTCLDTVVRCSNKGLKVLPKGIPKDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPVDITIQAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGENAGFWCTCADGFEGENCEVNIDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYIGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCVCPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIIRINEPICQCLPGYLGEKCEKLVSVNFVNKESYLQIPSAKVRPQTNITLQIATDEDSGILLYKGDKDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLTLDSSLSLSVDGGSPKVITNLSKQSTLNFDSPLYVGGMPGKNNVASLRQAPGQNGTSFHGCIRNLYINSELQDFRKMPMQTGILPGCEPCHKKVCAHGMCQPSSQSGFTCECEEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQMIKCKHGKCRLSGVGQPYCECNSGFTGDSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSFVDEVEKVVKCGCARCAS" ; affx:hasCds [affx:startsAt "46981771" ; affx:stopsAt "47299849" ]; affx:hasExon [ affx:relatesToExon :Slit2_e1; affx:cdsType "Partial" ; affx:cdsStart "46981771" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e14; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e16; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e18; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e19; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e20; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e21; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e22; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e23; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e24; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e25; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e26; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e27; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e28; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e29; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e30; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e31; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e32; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Slit2_e33; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Slit2_e34; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e35; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Slit2_e36; affx:cdsType "Partial" ; affx:cdsStop "47299849" ; affx:frame "1"] ; . :Slit2_e1 a affx:Exon ; affx:startsAt "46981524" ; affx:stopsAt "46981950" ; affx:commonToAll "1" . :Slit2_e2 a affx:Exon ; affx:startsAt "46984570" ; affx:stopsAt "46984642" ; affx:commonToAll "1" . :Slit2_e3 a affx:Exon ; affx:startsAt "46985851" ; affx:stopsAt "46985923" ; affx:commonToAll "1" . :Slit2_e4 a affx:Exon ; affx:startsAt "46997040" ; affx:stopsAt "46997112" ; affx:commonToAll "1" . :Slit2_e5 a affx:Exon ; affx:startsAt "47165679" ; affx:stopsAt "47165751" ; affx:commonToAll "1" . :Slit2_e6 a affx:Exon ; affx:startsAt "47177769" ; affx:stopsAt "47177841" ; affx:commonToAll "1" . :Slit2_e7 a affx:Exon ; affx:startsAt "47182019" ; affx:stopsAt "47182091" ; affx:commonToAll "1" . :Slit2_e8 a affx:Exon ; affx:startsAt "47184952" ; affx:stopsAt "47185116" ; affx:commonToAll "1" . :Slit2_e9 a affx:Exon ; affx:startsAt "47187716" ; affx:stopsAt "47187855" ; affx:commonToAll "1" . :Slit2_e10 a affx:Exon ; affx:startsAt "47206280" ; affx:stopsAt "47206352" ; affx:commonToAll "1" . :Slit2_e11 a affx:Exon ; affx:startsAt "47206807" ; affx:stopsAt "47206879" ; affx:commonToAll "1" . :Slit2_e12 a affx:Exon ; affx:startsAt "47212976" ; affx:stopsAt "47213048" ; affx:commonToAll "1" . :Slit2_e13 a affx:Exon ; affx:startsAt "47215186" ; affx:stopsAt "47215330" ; affx:commonToAll "1" . :Slit2_e14 a affx:Exon ; affx:startsAt "47215441" ; affx:stopsAt "47215605" ; affx:commonToAll "1" . :Slit2_e15 a affx:Exon ; affx:startsAt "47220177" ; affx:stopsAt "47220328" ; affx:commonToAll "1" . :Slit2_e16 a affx:Exon ; affx:startsAt "47225866" ; affx:stopsAt "47225941" ; affx:commonToAll "1" . :Slit2_e17 a affx:Exon ; affx:startsAt "47227518" ; affx:stopsAt "47227662" ; affx:commonToAll "1" . :Slit2_e18 a affx:Exon ; affx:startsAt "47230944" ; affx:stopsAt "47231088" ; affx:commonToAll "1" . :Slit2_e19 a affx:Exon ; affx:startsAt "47232862" ; affx:stopsAt "47233029" ; affx:commonToAll "1" . :Slit2_e20 a affx:Exon ; affx:startsAt "47233982" ; affx:stopsAt "47234115" ; affx:commonToAll "1" . :Slit2_e21 a affx:Exon ; affx:startsAt "47238156" ; affx:stopsAt "47238225" ; affx:commonToAll "1" . :Slit2_e22 a affx:Exon ; affx:startsAt "47240235" ; affx:stopsAt "47240307" ; affx:commonToAll "1" . :Slit2_e23 a affx:Exon ; affx:startsAt "47241184" ; affx:stopsAt "47241256" ; affx:commonToAll "1" . :Slit2_e24 a affx:Exon ; affx:startsAt "47242757" ; affx:stopsAt "47242829" ; affx:commonToAll "1" . :Slit2_e25 a affx:Exon ; affx:startsAt "47245385" ; affx:stopsAt "47245549" ; affx:commonToAll "1" . :Slit2_e26 a affx:Exon ; affx:startsAt "47252364" ; affx:stopsAt "47252489" ; affx:commonToAll "1" . :Slit2_e27 a affx:Exon ; affx:startsAt "47252613" ; affx:stopsAt "47252711" ; affx:commonToAll "1" . :Slit2_e28 a affx:Exon ; affx:startsAt "47255151" ; affx:stopsAt "47255291" ; affx:commonToAll "1" . :Slit2_e29 a affx:Exon ; affx:startsAt "47271189" ; affx:stopsAt "47271283" ; affx:commonToAll "1" . :Slit2_e30 a affx:Exon ; affx:startsAt "47277324" ; affx:stopsAt "47277462" ; affx:commonToAll "1" . :Slit2_e31 a affx:Exon ; affx:startsAt "47277552" ; affx:stopsAt "47277793" ; affx:commonToAll "1" . :Slit2_e32 a affx:Exon ; affx:startsAt "47278995" ; affx:stopsAt "47279126" ; affx:commonToAll "1" . :Slit2_e33 a affx:Exon ; affx:startsAt "47292016" ; affx:stopsAt "47292171" ; affx:commonToAll "1" . :Slit2_e34 a affx:Exon ; affx:startsAt "47297873" ; affx:stopsAt "47298162" ; affx:commonToAll "1" . :Slit2_e35 a affx:Exon ; affx:startsAt "47298360" ; affx:stopsAt "47298572" ; affx:commonToAll "1" . :Slit2_e36 a affx:Exon ; affx:startsAt "47299607" ; affx:stopsAt "47301120" ; affx:commonToAll "1" . :Gene4907 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi5748812] . :gi5748812 a affx:Transcript ; affx:unigene "iMm.34747" ; affx:translatesTo "MSTENVEGKPNNLGERGRARSSTFLRVFQPMFNHSIFTSAVSPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIADHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFSNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPTIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACLPPDPVNLSVSNDTTLAPEDLPTISSTDMYHNVTFDWAYLSKKECVKYGGKLVGNNCDFVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDNKPLDRERSSTFLERHTSC" ; affx:hasCds [affx:startsAt "88664209" ; affx:stopsAt "88871135" ]; affx:hasExon [ affx:relatesToExon :Gene4907_e1; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e12; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e15; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e19; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e20; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e21; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4907_e22; affx:cdsType "Partial" ; affx:cdsStop "88871135" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "9" ; affx:containsMotif [ affx:startsAt "425" ; affx:stopsAt "447" ; affx:spannedBy [ affx:startsAt "88771636" ; affx:stopsAt "88771702" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "460" ; affx:stopsAt "482" ; affx:spannedBy [ affx:startsAt "88785220" ; affx:stopsAt "88785286" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "511" ; affx:stopsAt "533" ; affx:spannedBy [ affx:startsAt "88792270" ; affx:stopsAt "88792336" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "682" ; affx:stopsAt "704" ; affx:spannedBy [ affx:startsAt "88833566" ; affx:stopsAt "88833632" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "731" ; affx:stopsAt "753" ; affx:spannedBy [ affx:startsAt "88835605" ; affx:stopsAt "88835671" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "774" ; affx:stopsAt "796" ; affx:spannedBy [ affx:startsAt "88850605" ; affx:stopsAt "88850671" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "834" ; affx:stopsAt "853" ; affx:spannedBy [ affx:startsAt "88851853" ; affx:stopsAt "88851910" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "860" ; affx:stopsAt "879" ; affx:spannedBy [ affx:startsAt "88859333" ; affx:stopsAt "88859384" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "88862064" ; affx:stopsAt "88862070" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "918" ; affx:stopsAt "940" ; affx:spannedBy [ affx:startsAt "88862187" ; affx:stopsAt "88862238" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "88865120" ; affx:stopsAt "88865135" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4907_e1 a affx:Exon ; affx:startsAt "88664209" ; affx:stopsAt "88664466" ; affx:commonToAll "1" . :Gene4907_e2 a affx:Exon ; affx:startsAt "88674488" ; affx:stopsAt "88674649" ; affx:commonToAll "1" . :Gene4907_e3 a affx:Exon ; affx:startsAt "88682250" ; affx:stopsAt "88682430" ; affx:commonToAll "1" . :Gene4907_e4 a affx:Exon ; affx:startsAt "88721434" ; affx:stopsAt "88721511" ; affx:commonToAll "1" . :Gene4907_e5 a affx:Exon ; affx:startsAt "88758307" ; affx:stopsAt "88758465" ; affx:commonToAll "1" . :Gene4907_e6 a affx:Exon ; affx:startsAt "88765544" ; affx:stopsAt "88765632" ; affx:commonToAll "1" . :Gene4907_e7 a affx:Exon ; affx:startsAt "88768276" ; affx:stopsAt "88768431" ; affx:commonToAll "1" . :Gene4907_e8 a affx:Exon ; affx:startsAt "88769062" ; affx:stopsAt "88769176" ; affx:commonToAll "1" . :Gene4907_e9 a affx:Exon ; affx:startsAt "88771551" ; affx:stopsAt "88771726" ; affx:commonToAll "1" . :Gene4907_e10 a affx:Exon ; affx:startsAt "88785205" ; affx:stopsAt "88785339" ; affx:commonToAll "1" . :Gene4907_e11 a affx:Exon ; affx:startsAt "88792236" ; affx:stopsAt "88792508" ; affx:commonToAll "1" . :Gene4907_e12 a affx:Exon ; affx:startsAt "88806656" ; affx:stopsAt "88806727" ; affx:commonToAll "1" . :Gene4907_e13 a affx:Exon ; affx:startsAt "88815558" ; affx:stopsAt "88815750" ; affx:commonToAll "1" . :Gene4907_e14 a affx:Exon ; affx:startsAt "88833554" ; affx:stopsAt "88833668" ; affx:commonToAll "1" . :Gene4907_e15 a affx:Exon ; affx:startsAt "88835560" ; affx:stopsAt "88835722" ; affx:commonToAll "1" . :Gene4907_e16 a affx:Exon ; affx:startsAt "88850593" ; affx:stopsAt "88850772" ; affx:commonToAll "1" . :Gene4907_e17 a affx:Exon ; affx:startsAt "88851840" ; affx:stopsAt "88851913" ; affx:commonToAll "1" . :Gene4907_e18 a affx:Exon ; affx:startsAt "88859315" ; affx:stopsAt "88859384" ; affx:commonToAll "1" . :Gene4907_e19 a affx:Exon ; affx:startsAt "88862064" ; affx:stopsAt "88862238" ; affx:commonToAll "1" . :Gene4907_e20 a affx:Exon ; affx:startsAt "88865120" ; affx:stopsAt "88865282" ; affx:commonToAll "1" . :Gene4907_e21 a affx:Exon ; affx:startsAt "88869058" ; affx:stopsAt "88869155" ; affx:commonToAll "1" . :Gene4907_e22 a affx:Exon ; affx:startsAt "88871091" ; affx:stopsAt "88871156" ; affx:commonToAll "1" . :Gene4908 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi16359301] ; affx:hasVariant [affx:representedBy :gi9651219] . :gi16359301 a affx:Transcript ; affx:unigene "iMm.41572" ; affx:translatesTo "MEGQDEVSAREQHFHSQVRESTICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLLLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRDSETTKPSANGHQKAL" ; affx:hasCds [affx:startsAt "27733767" ; affx:stopsAt "27878375" ]; affx:hasExon [ affx:relatesToExon :Gene4908_e1; affx:cdsType "Partial" ; affx:cdsStart "27733767" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e20; affx:cdsType "Partial" ; affx:cdsStop "27878375" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "21" ; affx:stopsAt "40" ; affx:spannedBy [ affx:startsAt "27878309" ; affx:stopsAt "27878312" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "27864084" ; affx:stopsAt "27864138" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "60" ; affx:stopsAt "82" ; affx:spannedBy [ affx:startsAt "27847578" ; affx:stopsAt "27847644" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "123" ; affx:stopsAt "145" ; affx:spannedBy [ affx:startsAt "27793564" ; affx:stopsAt "27793630" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "264" ; affx:stopsAt "286" ; affx:spannedBy [ affx:startsAt "27759384" ; affx:stopsAt "27759426" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27758817" ; affx:stopsAt "27758841" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "318" ; affx:stopsAt "340" ; affx:spannedBy [ affx:startsAt "27755251" ; affx:stopsAt "27755283" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27755004" ; affx:stopsAt "27755038" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "361" ; affx:stopsAt "383" ; affx:spannedBy [ affx:startsAt "27753448" ; affx:stopsAt "27753509" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27735839" ; affx:stopsAt "27735844" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "398" ; affx:stopsAt "420" ; affx:spannedBy [ affx:startsAt "27735728" ; affx:stopsAt "27735794" ; affx:inFrame "0" ] ; ] ; ] ; . :gi9651219 a affx:Transcript ; affx:unigene "iMm.41572" ; affx:translatesTo "MEGQDEVSAREQHFHSQVRESTICFLLFAILYIVSYFIIIRYKRKSDEQEDEDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLLLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRDSETTKPSANGHQKAL" ; affx:hasCds [affx:startsAt "27733767" ; affx:stopsAt "27878375" ]; affx:hasExon [ affx:relatesToExon :Gene4908_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4908_e19; affx:cdsType "Full" ; affx:frame "2"] ; affx:tmHMMHit [ affx:commonToAll "0" ; affx:motifCount "8" ; affx:containsMotif [ affx:startsAt "23" ; affx:stopsAt "40" ; affx:spannedBy [ affx:startsAt "27864084" ; affx:stopsAt "27864135" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "61" ; affx:stopsAt "83" ; affx:spannedBy [ affx:startsAt "27847575" ; affx:stopsAt "27847641" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "108" ; affx:stopsAt "130" ; affx:spannedBy [ affx:startsAt "27824617" ; affx:stopsAt "27824683" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "150" ; affx:stopsAt "172" ; affx:spannedBy [ affx:startsAt "27793564" ; affx:stopsAt "27793630" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "291" ; affx:stopsAt "313" ; affx:spannedBy [ affx:startsAt "27759384" ; affx:stopsAt "27759426" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27758817" ; affx:stopsAt "27758841" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "345" ; affx:stopsAt "367" ; affx:spannedBy [ affx:startsAt "27755251" ; affx:stopsAt "27755283" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27755004" ; affx:stopsAt "27755038" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "388" ; affx:stopsAt "410" ; affx:spannedBy [ affx:startsAt "27753448" ; affx:stopsAt "27753509" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "27735839" ; affx:stopsAt "27735844" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "425" ; affx:stopsAt "447" ; affx:spannedBy [ affx:startsAt "27735728" ; affx:stopsAt "27735794" ; affx:inFrame "0" ] ; ] ; ] ; . :Gene4908_e1 a affx:Exon ; affx:startsAt "27733077" ; affx:stopsAt "27733853" ; affx:commonToAll "0" . :Gene4908_e2 a affx:Exon ; affx:startsAt "27733767" ; affx:stopsAt "27733853" ; affx:commonToAll "0" . :Gene4908_e3 a affx:Exon ; affx:startsAt "27735682" ; affx:stopsAt "27735844" ; affx:commonToAll "1" . :Gene4908_e4 a affx:Exon ; affx:startsAt "27753448" ; affx:stopsAt "27753515" ; affx:commonToAll "1" . :Gene4908_e5 a affx:Exon ; affx:startsAt "27754947" ; affx:stopsAt "27755038" ; affx:commonToAll "1" . :Gene4908_e6 a affx:Exon ; affx:startsAt "27755251" ; affx:stopsAt "27755325" ; affx:commonToAll "1" . :Gene4908_e7 a affx:Exon ; affx:startsAt "27758763" ; affx:stopsAt "27758841" ; affx:commonToAll "1" . :Gene4908_e8 a affx:Exon ; affx:startsAt "27759384" ; affx:stopsAt "27759461" ; affx:commonToAll "1" . :Gene4908_e9 a affx:Exon ; affx:startsAt "27764100" ; affx:stopsAt "27764181" ; affx:commonToAll "1" . :Gene4908_e10 a affx:Exon ; affx:startsAt "27788098" ; affx:stopsAt "27788171" ; affx:commonToAll "1" . :Gene4908_e11 a affx:Exon ; affx:startsAt "27791980" ; affx:stopsAt "27792045" ; affx:commonToAll "1" . :Gene4908_e12 a affx:Exon ; affx:startsAt "27792859" ; affx:stopsAt "27792928" ; affx:commonToAll "1" . :Gene4908_e13 a affx:Exon ; affx:startsAt "27793530" ; affx:stopsAt "27793657" ; affx:commonToAll "1" . :Gene4908_e14 a affx:Exon ; affx:startsAt "27824584" ; affx:stopsAt "27824607" ; affx:commonToAll "0" . :Gene4908_e15 a affx:Exon ; affx:startsAt "27824584" ; affx:stopsAt "27824688" ; affx:commonToAll "0" . :Gene4908_e16 a affx:Exon ; affx:startsAt "27847505" ; affx:stopsAt "27847645" ; affx:commonToAll "1" . :Gene4908_e17 a affx:Exon ; affx:startsAt "27861230" ; affx:stopsAt "27861270" ; affx:commonToAll "1" . :Gene4908_e18 a affx:Exon ; affx:startsAt "27864065" ; affx:stopsAt "27864138" ; affx:commonToAll "1" . :Gene4908_e19 a affx:Exon ; affx:startsAt "27878309" ; affx:stopsAt "27878375" ; affx:commonToAll "0" . :Gene4908_e20 a affx:Exon ; affx:startsAt "27878309" ; affx:stopsAt "27878413" ; affx:commonToAll "0" . :Gene4909 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi16741399] . :gi16741399 a affx:Transcript ; affx:unigene "iMm.66253" ; affx:translatesTo "MPGLWRAIALKTLLGYVSWSLYHGLSPMIYYFPLQTLELTGLEFFCVAFLSPILLTIPPLWKLVNKKWTLSLLRIVTVGSIASFEAPNAKLRLMVLALGVSSSLIVQTVTWWSGSGLQRYLKIWGFILGHVLLLVLRIWYTSLNPIWSYQMSNRVILTLSAVAVLDRIGTDGDYRNPEGKKPREVATGRTSLSSWLLPGAAFGSLLFLTHWIFGEVSIVSRWAVSGHPHPGPDPNPFGGAVLLGFSSGLMLSGSSWLHDAGLAWWMTGAASAMGLLYLRTWAAAVSGCVLAVFTGSMWPQVLGHLVNSGKNSGEAMATGMILYVLQTFFCAWCTAFKFVPGGVYARERSDVLLGTIMVIIGLSMLFGPKKNLDFLLQTKNSPKTLLRCSEKYMKLILWLFVGVGLLGLGLRHRTYERQLGRGAPATVVSAAIWPFRFGYDNEGWPNLERSAQLLKETGADFITILESDASKPYIGNNDLTMWLGEKLGFYTDFGPSTRDHTWGIMVLSRYPIVRSEHHLLPSPEGEIAPAITMTVNVSNRLVDFVVTHFGNHEDDLDRKLQAIAVSKLLKNCSNQVIFLGYITSEPGSRDYIQLTKHGNVKDIDSSDGDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPANYRDNQKVVIDHRGVPKNIHFNPRFGSYKEGHNYENTHHFHMNTPKYFV" ; affx:hasCds [affx:startsAt "72524993" ; affx:stopsAt "72571890" ]; affx:hasExon [ affx:relatesToExon :Gene4909_e1; affx:cdsType "Partial" ; affx:cdsStart "72524993" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e13; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e15; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4909_e16; affx:cdsType "Partial" ; affx:cdsStop "72571890" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "19" ; affx:spannedBy [ affx:startsAt "72524993" ; affx:stopsAt "72525036" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "72526877" ; affx:stopsAt "72526891" ; affx:inFrame "0" ] ; ] ; ] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "9" ; affx:containsMotif [ affx:startsAt "39" ; affx:stopsAt "61" ; affx:spannedBy [ affx:startsAt "72526951" ; affx:stopsAt "72527017" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "91" ; affx:stopsAt "113" ; affx:spannedBy [ affx:startsAt "72530630" ; affx:stopsAt "72530696" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "123" ; affx:stopsAt "140" ; affx:spannedBy [ affx:startsAt "72531763" ; affx:stopsAt "72531814" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "191" ; affx:stopsAt "213" ; affx:spannedBy [ affx:startsAt "72533735" ; affx:stopsAt "72533801" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "236" ; affx:stopsAt "258" ; affx:spannedBy [ affx:startsAt "72533870" ; affx:stopsAt "72533875" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "72535449" ; affx:stopsAt "72535510" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "275" ; affx:stopsAt "297" ; affx:spannedBy [ affx:startsAt "72536708" ; affx:stopsAt "72536774" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "317" ; affx:stopsAt "339" ; affx:spannedBy [ affx:startsAt "72536834" ; affx:stopsAt "72536900" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "351" ; affx:stopsAt "368" ; affx:spannedBy [ affx:startsAt "72536936" ; affx:stopsAt "72536943" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "72540195" ; affx:stopsAt "72540239" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "395" ; affx:stopsAt "412" ; affx:spannedBy [ affx:startsAt "72542849" ; affx:stopsAt "72542899" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4909_e1 a affx:Exon ; affx:startsAt "72524881" ; affx:stopsAt "72525036" ; affx:commonToAll "1" . :Gene4909_e2 a affx:Exon ; affx:startsAt "72526877" ; affx:stopsAt "72527069" ; affx:commonToAll "1" . :Gene4909_e3 a affx:Exon ; affx:startsAt "72530592" ; affx:stopsAt "72530713" ; affx:commonToAll "1" . :Gene4909_e4 a affx:Exon ; affx:startsAt "72531750" ; affx:stopsAt "72531905" ; affx:commonToAll "1" . :Gene4909_e5 a affx:Exon ; affx:startsAt "72533673" ; affx:stopsAt "72533875" ; affx:commonToAll "1" . :Gene4909_e6 a affx:Exon ; affx:startsAt "72535449" ; affx:stopsAt "72535538" ; affx:commonToAll "1" . :Gene4909_e7 a affx:Exon ; affx:startsAt "72536685" ; affx:stopsAt "72536943" ; affx:commonToAll "1" . :Gene4909_e8 a affx:Exon ; affx:startsAt "72540195" ; affx:stopsAt "72540321" ; affx:commonToAll "1" . :Gene4909_e9 a affx:Exon ; affx:startsAt "72542849" ; affx:stopsAt "72542929" ; affx:commonToAll "1" . :Gene4909_e10 a affx:Exon ; affx:startsAt "72547501" ; affx:stopsAt "72547607" ; affx:commonToAll "1" . :Gene4909_e11 a affx:Exon ; affx:startsAt "72549346" ; affx:stopsAt "72549482" ; affx:commonToAll "1" . :Gene4909_e12 a affx:Exon ; affx:startsAt "72550758" ; affx:stopsAt "72550908" ; affx:commonToAll "1" . :Gene4909_e13 a affx:Exon ; affx:startsAt "72553158" ; affx:stopsAt "72553303" ; affx:commonToAll "1" . :Gene4909_e14 a affx:Exon ; affx:startsAt "72557369" ; affx:stopsAt "72557431" ; affx:commonToAll "1" . :Gene4909_e15 a affx:Exon ; affx:startsAt "72560239" ; affx:stopsAt "72560395" ; affx:commonToAll "1" . :Gene4909_e16 a affx:Exon ; affx:startsAt "72571811" ; affx:stopsAt "72572089" ; affx:commonToAll "1" . :Gene4910 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13278488] . :gi13278488 a affx:Transcript ; affx:unigene "iMm.190624" ; affx:translatesTo "MILLIFLKQRQAELEAVRLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKVCQTAGVAARMSARLEA" ; affx:hasCds [affx:startsAt "20202608" ; affx:stopsAt "20202836" ]; affx:hasExon [ affx:relatesToExon :Gene4910_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4910_e2; affx:cdsType "Partial" ; affx:cdsStart "20202608" ; affx:cdsStop "20202836" ; affx:frame "2"] ; . :Gene4910_e1 a affx:Exon ; affx:startsAt "20191403" ; affx:stopsAt "20191738" ; affx:commonToAll "1" . :Gene4910_e2 a affx:Exon ; affx:startsAt "20200553" ; affx:stopsAt "20202906" ; affx:commonToAll "1" . :Gene4911 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13542762] . :gi13542762 a affx:Transcript ; affx:unigene "iMm.30147" ; affx:translatesTo "MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKKTLAKPNMKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSDVPIRHSRNMRKMMLDLNKAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNETMGHSADRLAAAFAVSRMEQDEYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGRKTKVGSPPLEKFNIWGGSLSLGHPFGATGCRLVMAAANRLRKDGGQYALVAACAAGGQGHAMIVEAYPK" ; affx:hasCds [affx:startsAt "28670883" ; affx:stopsAt "28691295" ]; affx:hasExon [ affx:relatesToExon :Gene4911_e1; affx:cdsType "Partial" ; affx:cdsStart "28670883" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4911_e15; affx:cdsType "Partial" ; affx:cdsStop "28691295" ; affx:frame "2"] ; . :Gene4911_e1 a affx:Exon ; affx:startsAt "28670873" ; affx:stopsAt "28670950" ; affx:commonToAll "1" . :Gene4911_e2 a affx:Exon ; affx:startsAt "28671232" ; affx:stopsAt "28671277" ; affx:commonToAll "1" . :Gene4911_e3 a affx:Exon ; affx:startsAt "28673871" ; affx:stopsAt "28673971" ; affx:commonToAll "1" . :Gene4911_e4 a affx:Exon ; affx:startsAt "28675730" ; affx:stopsAt "28675775" ; affx:commonToAll "1" . :Gene4911_e5 a affx:Exon ; affx:startsAt "28676702" ; affx:stopsAt "28676802" ; affx:commonToAll "1" . :Gene4911_e6 a affx:Exon ; affx:startsAt "28679832" ; affx:stopsAt "28679920" ; affx:commonToAll "1" . :Gene4911_e7 a affx:Exon ; affx:startsAt "28681016" ; affx:stopsAt "28681204" ; affx:commonToAll "1" . :Gene4911_e8 a affx:Exon ; affx:startsAt "28681997" ; affx:stopsAt "28682178" ; affx:commonToAll "1" . :Gene4911_e9 a affx:Exon ; affx:startsAt "28684094" ; affx:stopsAt "28684216" ; affx:commonToAll "1" . :Gene4911_e10 a affx:Exon ; affx:startsAt "28685846" ; affx:stopsAt "28685926" ; affx:commonToAll "1" . :Gene4911_e11 a affx:Exon ; affx:startsAt "28686003" ; affx:stopsAt "28686051" ; affx:commonToAll "1" . :Gene4911_e12 a affx:Exon ; affx:startsAt "28686758" ; affx:stopsAt "28686846" ; affx:commonToAll "1" . :Gene4911_e13 a affx:Exon ; affx:startsAt "28687521" ; affx:stopsAt "28687596" ; affx:commonToAll "1" . :Gene4911_e14 a affx:Exon ; affx:startsAt "28688127" ; affx:stopsAt "28688292" ; affx:commonToAll "1" . :Gene4911_e15 a affx:Exon ; affx:startsAt "28691259" ; affx:stopsAt "28691790" ; affx:commonToAll "1" . :Gene4912 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13278593] . :gi13278593 a affx:Transcript ; affx:unigene "iMm.33830" ; affx:translatesTo "MRLVILDNYDLASEWAAKYICNRIIKFKPGQDRYFSLGLPTGSTPLGCYKKLIEYHKSGNLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFEEKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAMEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLYSMKEGN" ; affx:hasCds [affx:startsAt "68658404" ; affx:stopsAt "68674288" ]; affx:hasExon [ affx:relatesToExon :Gene4912_e1; affx:cdsType "Partial" ; affx:cdsStart "68658404" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e6; affx:cdsType "Partial" ; affx:cdsStop "68674288" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4912_e7; affx:cdsType "None" ] ; . :Gene4912_e1 a affx:Exon ; affx:startsAt "68657513" ; affx:stopsAt "68658466" ; affx:commonToAll "1" . :Gene4912_e2 a affx:Exon ; affx:startsAt "68660490" ; affx:stopsAt "68660665" ; affx:commonToAll "1" . :Gene4912_e3 a affx:Exon ; affx:startsAt "68664364" ; affx:stopsAt "68664549" ; affx:commonToAll "1" . :Gene4912_e4 a affx:Exon ; affx:startsAt "68669477" ; affx:stopsAt "68669660" ; affx:commonToAll "1" . :Gene4912_e5 a affx:Exon ; affx:startsAt "68670968" ; affx:stopsAt "68671070" ; affx:commonToAll "1" . :Gene4912_e6 a affx:Exon ; affx:startsAt "68674164" ; affx:stopsAt "68674327" ; affx:commonToAll "1" . :Gene4912_e7 a affx:Exon ; affx:startsAt "68676711" ; affx:stopsAt "68676789" ; affx:commonToAll "1" . :Gene4913 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13435573] . :gi13435573 a affx:Transcript ; affx:unigene "iMm.3981" ; affx:translatesTo "MAAAAAAGANGSGGSSGMEVDAAVPSVMASGVTGSVSVALHPLVILNISDHWIRMRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF" ; affx:hasCds [affx:startsAt "136866015" ; affx:stopsAt "136868779" ]; affx:hasExon [ affx:relatesToExon :Gene4913_e1; affx:cdsType "Partial" ; affx:cdsStart "136866015" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4913_e10; affx:cdsType "Partial" ; affx:cdsStop "136868779" ; affx:frame "0"] ; . :Gene4913_e1 a affx:Exon ; affx:startsAt "136866005" ; affx:stopsAt "136866085" ; affx:commonToAll "1" . :Gene4913_e2 a affx:Exon ; affx:startsAt "136866277" ; affx:stopsAt "136866400" ; affx:commonToAll "1" . :Gene4913_e3 a affx:Exon ; affx:startsAt "136866576" ; affx:stopsAt "136866708" ; affx:commonToAll "1" . :Gene4913_e4 a affx:Exon ; affx:startsAt "136867039" ; affx:stopsAt "136867128" ; affx:commonToAll "1" . :Gene4913_e5 a affx:Exon ; affx:startsAt "136867224" ; affx:stopsAt "136867287" ; affx:commonToAll "1" . :Gene4913_e6 a affx:Exon ; affx:startsAt "136867637" ; affx:stopsAt "136867685" ; affx:commonToAll "1" . :Gene4913_e7 a affx:Exon ; affx:startsAt "136868032" ; affx:stopsAt "136868147" ; affx:commonToAll "1" . :Gene4913_e8 a affx:Exon ; affx:startsAt "136868229" ; affx:stopsAt "136868322" ; affx:commonToAll "1" . :Gene4913_e9 a affx:Exon ; affx:startsAt "136868411" ; affx:stopsAt "136868512" ; affx:commonToAll "1" . :Gene4913_e10 a affx:Exon ; affx:startsAt "136868638" ; affx:stopsAt "136868887" ; affx:commonToAll "1" . :Gene4914 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13529670] . :gi13529670 a affx:Transcript ; affx:unigene "iMm.32126" ; affx:translatesTo "MSRLQTEEQAVDSEGDSSLHRRNEEGTQSSHRMLGFSDALLSIIATVMILPVTHTEISPEQQFDKSIQKLLATRIAVYLMTFLIVTVAWTAHTRLFQVVGKIDDTLALLNLACMMTITLLPYTFSLMVTFPDVPLGIFLFCVCVIAIGSVQAMIVGYAFHFPHLLNPQIQCSTHRDLSRRHILHLVLRGPALCFVAAVFSLFFFPLSYLLMVTVIFLPHISKATTWCKDKLMGQRESPAHDMEPFSIDLHAPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVQEKFSGSLVAALGAYGPQFLAYFGSFATVGLLWFAHHSLFLHVRKATQTMGLLNILSLAFVGGLPLAYQQTSAFARQPHDELERVRVSCAIIFFASIFQFAIWTTALLHQTETLQPAVQFGGQEHAFMFAKLALYPCASLLAFAATCLLSRFSTAIFHLMQISVPFAFLLLRLLVRLALAGLQVLRGLWPHHPQQDQSEPEAQSQLLPDPC" ; affx:hasCds [affx:startsAt "106318030" ; affx:stopsAt "106326193" ]; affx:hasExon [ affx:relatesToExon :Gene4914_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4914_e2; affx:cdsType "Partial" ; affx:cdsStart "106318030" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e7; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e9; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e10; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4914_e11; affx:cdsType "Partial" ; affx:cdsStop "106326193" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "7" ; affx:containsMotif [ affx:startsAt "70" ; affx:stopsAt "91" ; affx:spannedBy [ affx:startsAt "106319182" ; affx:stopsAt "106319245" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "106" ; affx:stopsAt "128" ; affx:spannedBy [ affx:startsAt "106321546" ; affx:stopsAt "106321561" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "106321804" ; affx:stopsAt "106321840" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "106322383" ; affx:stopsAt "106322398" ; affx:inFrame "2" ] ; ] ; affx:containsMotif [ affx:startsAt "135" ; affx:stopsAt "157" ; affx:spannedBy [ affx:startsAt "106322419" ; affx:stopsAt "106322467" ; affx:inFrame "2" ] ; affx:spannedBy [ affx:startsAt "106322726" ; affx:stopsAt "106322744" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "195" ; affx:stopsAt "217" ; affx:spannedBy [ affx:startsAt "106322858" ; affx:stopsAt "106322891" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "106323855" ; affx:stopsAt "106323888" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "334" ; affx:stopsAt "356" ; affx:spannedBy [ affx:startsAt "106325695" ; affx:stopsAt "106325761" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "373" ; affx:stopsAt "395" ; affx:spannedBy [ affx:startsAt "106325812" ; affx:stopsAt "106325878" ; affx:inFrame "1" ] ; ] ; affx:containsMotif [ affx:startsAt "415" ; affx:stopsAt "437" ; affx:spannedBy [ affx:startsAt "106325938" ; affx:stopsAt "106326004" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4914_e1 a affx:Exon ; affx:startsAt "106309634" ; affx:stopsAt "106309676" ; affx:commonToAll "1" . :Gene4914_e2 a affx:Exon ; affx:startsAt "106317956" ; affx:stopsAt "106318174" ; affx:commonToAll "1" . :Gene4914_e3 a affx:Exon ; affx:startsAt "106318350" ; affx:stopsAt "106318389" ; affx:commonToAll "1" . :Gene4914_e4 a affx:Exon ; affx:startsAt "106319155" ; affx:stopsAt "106319253" ; affx:commonToAll "1" . :Gene4914_e5 a affx:Exon ; affx:startsAt "106321509" ; affx:stopsAt "106321561" ; affx:commonToAll "1" . :Gene4914_e6 a affx:Exon ; affx:startsAt "106321804" ; affx:stopsAt "106321840" ; affx:commonToAll "1" . :Gene4914_e7 a affx:Exon ; affx:startsAt "106322383" ; affx:stopsAt "106322467" ; affx:commonToAll "1" . :Gene4914_e8 a affx:Exon ; affx:startsAt "106322726" ; affx:stopsAt "106322891" ; affx:commonToAll "1" . :Gene4914_e9 a affx:Exon ; affx:startsAt "106323855" ; affx:stopsAt "106323934" ; affx:commonToAll "1" . :Gene4914_e10 a affx:Exon ; affx:startsAt "106324244" ; affx:stopsAt "106324380" ; affx:commonToAll "1" . :Gene4914_e11 a affx:Exon ; affx:startsAt "106325526" ; affx:stopsAt "106326951" ; affx:commonToAll "1" . :Gene4915 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi17391089] . :gi17391089 a affx:Transcript ; affx:unigene "iMm.22029" ; affx:translatesTo "MSEGESQTVVSSGSDPKVESSSLAPGLTSVSPPVTSTTSAASPEEEEESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADVKENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFIQHNGLIKIGSVAPDTINNHVKTCREEQKNLHFFAPEYGEVTNVTTAVDIYSFGMCALEMAVLEIQGNGESSYVPQEAISSAIQLLEDSLQREFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHCIVGHQHMIPENALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVRNGIYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTPEPAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNESIPDLAAELVQLGFISEADQSRLTSLLEETLNKFNFTRNSTLNTATVTVSS" ; affx:hasCds [affx:startsAt "29911845" ; affx:stopsAt "29919295" ]; affx:hasExon [ affx:relatesToExon :Gene4915_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4915_e2; affx:cdsType "Partial" ; affx:cdsStart "29911845" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e8; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e11; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e13; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e16; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e17; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4915_e18; affx:cdsType "Partial" ; affx:cdsStop "29919295" ; affx:frame "1"] ; . :Gene4915_e1 a affx:Exon ; affx:startsAt "29909007" ; affx:stopsAt "29909066" ; affx:commonToAll "1" . :Gene4915_e2 a affx:Exon ; affx:startsAt "29911826" ; affx:stopsAt "29912055" ; affx:commonToAll "1" . :Gene4915_e3 a affx:Exon ; affx:startsAt "29912331" ; affx:stopsAt "29912454" ; affx:commonToAll "1" . :Gene4915_e4 a affx:Exon ; affx:startsAt "29912623" ; affx:stopsAt "29912725" ; affx:commonToAll "1" . :Gene4915_e5 a affx:Exon ; affx:startsAt "29913042" ; affx:stopsAt "29913132" ; affx:commonToAll "1" . :Gene4915_e6 a affx:Exon ; affx:startsAt "29913528" ; affx:stopsAt "29913569" ; affx:commonToAll "1" . :Gene4915_e7 a affx:Exon ; affx:startsAt "29913916" ; affx:stopsAt "29914011" ; affx:commonToAll "1" . :Gene4915_e8 a affx:Exon ; affx:startsAt "29915507" ; affx:stopsAt "29915591" ; affx:commonToAll "1" . :Gene4915_e9 a affx:Exon ; affx:startsAt "29915849" ; affx:stopsAt "29915908" ; affx:commonToAll "1" . :Gene4915_e10 a affx:Exon ; affx:startsAt "29916063" ; affx:stopsAt "29916162" ; affx:commonToAll "1" . :Gene4915_e11 a affx:Exon ; affx:startsAt "29917714" ; affx:stopsAt "29917847" ; affx:commonToAll "1" . :Gene4915_e12 a affx:Exon ; affx:startsAt "29918054" ; affx:stopsAt "29918160" ; affx:commonToAll "1" . :Gene4915_e13 a affx:Exon ; affx:startsAt "29918255" ; affx:stopsAt "29918306" ; affx:commonToAll "1" . :Gene4915_e14 a affx:Exon ; affx:startsAt "29918395" ; affx:stopsAt "29918531" ; affx:commonToAll "1" . :Gene4915_e15 a affx:Exon ; affx:startsAt "29918709" ; affx:stopsAt "29918763" ; affx:commonToAll "1" . :Gene4915_e16 a affx:Exon ; affx:startsAt "29918846" ; affx:stopsAt "29918910" ; affx:commonToAll "1" . :Gene4915_e17 a affx:Exon ; affx:startsAt "29919057" ; affx:stopsAt "29919113" ; affx:commonToAll "1" . :Gene4915_e18 a affx:Exon ; affx:startsAt "29919190" ; affx:stopsAt "29919730" ; affx:commonToAll "1" . :Gene4916 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13277965] . :gi13277965 a affx:Transcript ; affx:unigene "iMm.29784" ; affx:translatesTo "MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE" ; affx:hasCds [affx:startsAt "128674948" ; affx:stopsAt "128683955" ]; affx:hasExon [ affx:relatesToExon :Gene4916_e1; affx:cdsType "Partial" ; affx:cdsStart "128674948" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4916_e2; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4916_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4916_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4916_e5; affx:cdsType "Partial" ; affx:cdsStop "128683955" ; affx:frame "1"] ; . :Gene4916_e1 a affx:Exon ; affx:startsAt "128674347" ; affx:stopsAt "128675077" ; affx:commonToAll "1" . :Gene4916_e2 a affx:Exon ; affx:startsAt "128676901" ; affx:stopsAt "128677066" ; affx:commonToAll "1" . :Gene4916_e3 a affx:Exon ; affx:startsAt "128679429" ; affx:stopsAt "128679630" ; affx:commonToAll "1" . :Gene4916_e4 a affx:Exon ; affx:startsAt "128682554" ; affx:stopsAt "128682684" ; affx:commonToAll "1" . :Gene4916_e5 a affx:Exon ; affx:startsAt "128683827" ; affx:stopsAt "128684080" ; affx:commonToAll "1" . :Gene4917 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13435415] . :gi13435415 a affx:Transcript ; affx:unigene "iMm.28890" ; affx:translatesTo "MGTLATRAACHGAHLALALLLLLSLSGPWLSAVVPGTPPLFNVSLDAAPEQRWLPMLRHYDPDFLRTAVAQVIGDRVPQWVLGMVGEIVSKVESFLPQPFTDEIRSICDSLNLSLADGILVNLAYEASAFCTSIVAQDSQGHIYHGRNLDYPFGKILRKLTANVQFIKNGQIAFTGTTFVGYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWLIRKTLSESESFEAAVYTLAKTPLIADVYYIVGGTSPKEGVVITRDRGGPADIWPLDPLNGEWFRVETNYDHWKPAPKVDDRRTPAIKALNATGQAHLNLETLFQVLSLFPVYNNYTIYTTVMSAAEPDKYLTMIRNPS" ; affx:hasCds [affx:startsAt "91916905" ; affx:stopsAt "91936483" ]; affx:hasExon [ affx:relatesToExon :Gene4917_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4917_e2; affx:cdsType "Partial" ; affx:cdsStart "91916905" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e4; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e7; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e8; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4917_e11; affx:cdsType "Partial" ; affx:cdsStop "91936483" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "1" ; affx:containsMotif [ affx:startsAt "0" ; affx:stopsAt "31" ; affx:spannedBy [ affx:startsAt "91936390" ; affx:stopsAt "91936483" ; affx:inFrame "1" ] ; ] ; ] ; . :Gene4917_e1 a affx:Exon ; affx:startsAt "91915597" ; affx:stopsAt "91916293" ; affx:commonToAll "1" . :Gene4917_e2 a affx:Exon ; affx:startsAt "91916903" ; affx:stopsAt "91916981" ; affx:commonToAll "1" . :Gene4917_e3 a affx:Exon ; affx:startsAt "91919287" ; affx:stopsAt "91919316" ; affx:commonToAll "1" . :Gene4917_e4 a affx:Exon ; affx:startsAt "91920859" ; affx:stopsAt "91920926" ; affx:commonToAll "1" . :Gene4917_e5 a affx:Exon ; affx:startsAt "91921760" ; affx:stopsAt "91921823" ; affx:commonToAll "1" . :Gene4917_e6 a affx:Exon ; affx:startsAt "91921941" ; affx:stopsAt "91922114" ; affx:commonToAll "1" . :Gene4917_e7 a affx:Exon ; affx:startsAt "91923431" ; affx:stopsAt "91923508" ; affx:commonToAll "1" . :Gene4917_e8 a affx:Exon ; affx:startsAt "91926392" ; affx:stopsAt "91926483" ; affx:commonToAll "1" . :Gene4917_e9 a affx:Exon ; affx:startsAt "91930794" ; affx:stopsAt "91930921" ; affx:commonToAll "1" . :Gene4917_e10 a affx:Exon ; affx:startsAt "91935269" ; affx:stopsAt "91935434" ; affx:commonToAll "1" . :Gene4917_e11 a affx:Exon ; affx:startsAt "91936262" ; affx:stopsAt "91936502" ; affx:commonToAll "1" . :Gene4918 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13542712] . :gi13542712 a affx:Transcript ; affx:unigene "iMm.110600" ; affx:translatesTo "MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDAKGSNSLPLLRSFLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFISRLAPTVA" ; affx:hasCds [affx:startsAt "66333336" ; affx:stopsAt "66359063" ]; affx:hasExon [ affx:relatesToExon :Gene4918_e1; affx:cdsType "None" ] ; affx:hasExon [ affx:relatesToExon :Gene4918_e2; affx:cdsType "Partial" ; affx:cdsStart "66333336" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e6; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4918_e8; affx:cdsType "Partial" ; affx:cdsStop "66359063" ; affx:frame "1"] ; affx:tmHMMHit [ affx:commonToAll "1" ; affx:motifCount "2" ; affx:containsMotif [ affx:startsAt "27" ; affx:stopsAt "49" ; affx:spannedBy [ affx:startsAt "66336113" ; affx:stopsAt "66336172" ; affx:inFrame "1" ] ; affx:spannedBy [ affx:startsAt "66336617" ; affx:stopsAt "66336624" ; affx:inFrame "0" ] ; ] ; affx:containsMotif [ affx:startsAt "96" ; affx:stopsAt "118" ; affx:spannedBy [ affx:startsAt "66336765" ; affx:stopsAt "66336805" ; affx:inFrame "0" ] ; affx:spannedBy [ affx:startsAt "66339649" ; affx:stopsAt "66339675" ; affx:inFrame "2" ] ; ] ; ] ; . :Gene4918_e1 a affx:Exon ; affx:startsAt "66333111" ; affx:stopsAt "66333154" ; affx:commonToAll "1" . :Gene4918_e2 a affx:Exon ; affx:startsAt "66333311" ; affx:stopsAt "66333381" ; affx:commonToAll "1" . :Gene4918_e3 a affx:Exon ; affx:startsAt "66336077" ; affx:stopsAt "66336172" ; affx:commonToAll "1" . :Gene4918_e4 a affx:Exon ; affx:startsAt "66336617" ; affx:stopsAt "66336805" ; affx:commonToAll "1" . :Gene4918_e5 a affx:Exon ; affx:startsAt "66339649" ; affx:stopsAt "66339717" ; affx:commonToAll "1" . :Gene4918_e6 a affx:Exon ; affx:startsAt "66340859" ; affx:stopsAt "66340993" ; affx:commonToAll "1" . :Gene4918_e7 a affx:Exon ; affx:startsAt "66356977" ; affx:stopsAt "66357061" ; affx:commonToAll "1" . :Gene4918_e8 a affx:Exon ; affx:startsAt "66358933" ; affx:stopsAt "66359367" ; affx:commonToAll "1" . :Gene4919 a affx:Gene ; affx:strand "-" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13435427] . :gi13435427 a affx:Transcript ; affx:unigene "iMm.41555" ; affx:translatesTo "MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSEESETQPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPLSRTVNPPRSSMCAVQ" ; affx:hasCds [affx:startsAt "40601337" ; affx:stopsAt "40683884" ]; affx:hasExon [ affx:relatesToExon :Gene4919_e1; affx:cdsType "Partial" ; affx:cdsStart "40601337" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e3; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4919_e7; affx:cdsType "Partial" ; affx:cdsStop "40683884" ; affx:frame "2"] ; . :Gene4919_e1 a affx:Exon ; affx:startsAt "40600543" ; affx:stopsAt "40601430" ; affx:commonToAll "1" . :Gene4919_e2 a affx:Exon ; affx:startsAt "40608740" ; affx:stopsAt "40608818" ; affx:commonToAll "1" . :Gene4919_e3 a affx:Exon ; affx:startsAt "40611641" ; affx:stopsAt "40611745" ; affx:commonToAll "1" . :Gene4919_e4 a affx:Exon ; affx:startsAt "40663573" ; affx:stopsAt "40663703" ; affx:commonToAll "1" . :Gene4919_e5 a affx:Exon ; affx:startsAt "40674293" ; affx:stopsAt "40674382" ; affx:commonToAll "1" . :Gene4919_e6 a affx:Exon ; affx:startsAt "40679342" ; affx:stopsAt "40679439" ; affx:commonToAll "1" . :Gene4919_e7 a affx:Exon ; affx:startsAt "40683809" ; affx:stopsAt "40684060" ; affx:commonToAll "1" . :Gene4920 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi13529469] . :gi13529469 a affx:Transcript ; affx:unigene "iMm.2462" ; affx:translatesTo "MPDYLGADQRKTKEEEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN" ; affx:hasCds [affx:startsAt "20223018" ; affx:stopsAt "20239908" ]; affx:hasExon [ affx:relatesToExon :Gene4920_e1; affx:cdsType "Partial" ; affx:cdsStart "20223018" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e4; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e5; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e9; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e10; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e11; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4920_e12; affx:cdsType "Partial" ; affx:cdsStop "20239908" ; affx:frame "1"] ; . :Gene4920_e1 a affx:Exon ; affx:startsAt "20222968" ; affx:stopsAt "20223088" ; affx:commonToAll "1" . :Gene4920_e2 a affx:Exon ; affx:startsAt "20231311" ; affx:stopsAt "20231349" ; affx:commonToAll "1" . :Gene4920_e3 a affx:Exon ; affx:startsAt "20231966" ; affx:stopsAt "20232048" ; affx:commonToAll "1" . :Gene4920_e4 a affx:Exon ; affx:startsAt "20232736" ; affx:stopsAt "20232836" ; affx:commonToAll "1" . :Gene4920_e5 a affx:Exon ; affx:startsAt "20235626" ; affx:stopsAt "20235758" ; affx:commonToAll "1" . :Gene4920_e6 a affx:Exon ; affx:startsAt "20236139" ; affx:stopsAt "20236212" ; affx:commonToAll "1" . :Gene4920_e7 a affx:Exon ; affx:startsAt "20236747" ; affx:stopsAt "20236843" ; affx:commonToAll "1" . :Gene4920_e8 a affx:Exon ; affx:startsAt "20237411" ; affx:stopsAt "20237576" ; affx:commonToAll "1" . :Gene4920_e9 a affx:Exon ; affx:startsAt "20238729" ; affx:stopsAt "20238817" ; affx:commonToAll "1" . :Gene4920_e10 a affx:Exon ; affx:startsAt "20239273" ; affx:stopsAt "20239476" ; affx:commonToAll "1" . :Gene4920_e11 a affx:Exon ; affx:startsAt "20239569" ; affx:stopsAt "20239666" ; affx:commonToAll "1" . :Gene4920_e12 a affx:Exon ; affx:startsAt "20239750" ; affx:stopsAt "20239989" ; affx:commonToAll "1" . :Gene4921 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15214573] . :gi15214573 a affx:Transcript ; affx:unigene "iMm.100043" ; affx:translatesTo "MPSTKRYQHVIETPEPGEWELSGYEAAVPITEKSNPLTRNLDKADAEKIVQLLGQCDAEIFQEEGQIMPTYQRLYSESVLTTMLQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEELKKVAAGKKRVVVIGISVGLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDWRSTFRQVAERMQKMQEKQEAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGVVSSQRCLLEILRTFERAHQVTYSQSSKIATLTKQVGISLEKKGHVHLVGWQTLGIIAIMDGVECIHTFGADFRDIRGFLIGDHNDMFNQKDELSNQGPQFTFSQDDFLTSVLPSLTEIDTVVFIFTLDDNLAKVQALAERVREKSWNIQALVHSTVGQSLPAPLKKLFPSLISITWPLLFFDYEGSYVQKFQRELSTKWVLNTRFSGQSKARCIESLLQVIHFPQPLSNDVRAAPISCHVQVAHEKEKVIPTALLSLLLRCSITEAKERLAAASSVCEVVRSALSGPGQKRSIQAFGDPVVP" ; affx:hasCds [affx:startsAt "29965962" ; affx:stopsAt "29995438" ]; affx:hasExon [ affx:relatesToExon :Gene4921_e1; affx:cdsType "Partial" ; affx:cdsStart "29965962" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e2; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e3; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e5; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e6; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e7; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e8; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e9; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e10; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e11; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e12; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e13; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e14; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e15; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e16; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e17; affx:cdsType "Full" ; affx:frame "1"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e18; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4921_e19; affx:cdsType "Partial" ; affx:cdsStop "29995438" ; affx:frame "0"] ; . :Gene4921_e1 a affx:Exon ; affx:startsAt "29965923" ; affx:stopsAt "29966022" ; affx:commonToAll "1" . :Gene4921_e2 a affx:Exon ; affx:startsAt "29966507" ; affx:stopsAt "29966663" ; affx:commonToAll "1" . :Gene4921_e3 a affx:Exon ; affx:startsAt "29967056" ; affx:stopsAt "29967125" ; affx:commonToAll "1" . :Gene4921_e4 a affx:Exon ; affx:startsAt "29967900" ; affx:stopsAt "29967969" ; affx:commonToAll "1" . :Gene4921_e5 a affx:Exon ; affx:startsAt "29968341" ; affx:stopsAt "29968415" ; affx:commonToAll "1" . :Gene4921_e6 a affx:Exon ; affx:startsAt "29968921" ; affx:stopsAt "29968988" ; affx:commonToAll "1" . :Gene4921_e7 a affx:Exon ; affx:startsAt "29969154" ; affx:stopsAt "29969208" ; affx:commonToAll "1" . :Gene4921_e8 a affx:Exon ; affx:startsAt "29970503" ; affx:stopsAt "29970598" ; affx:commonToAll "1" . :Gene4921_e9 a affx:Exon ; affx:startsAt "29973315" ; affx:stopsAt "29973421" ; affx:commonToAll "1" . :Gene4921_e10 a affx:Exon ; affx:startsAt "29974834" ; affx:stopsAt "29974953" ; affx:commonToAll "1" . :Gene4921_e11 a affx:Exon ; affx:startsAt "29975412" ; affx:stopsAt "29975511" ; affx:commonToAll "1" . :Gene4921_e12 a affx:Exon ; affx:startsAt "29975667" ; affx:stopsAt "29975765" ; affx:commonToAll "1" . :Gene4921_e13 a affx:Exon ; affx:startsAt "29976101" ; affx:stopsAt "29976178" ; affx:commonToAll "1" . :Gene4921_e14 a affx:Exon ; affx:startsAt "29976531" ; affx:stopsAt "29976628" ; affx:commonToAll "1" . :Gene4921_e15 a affx:Exon ; affx:startsAt "29977182" ; affx:stopsAt "29977280" ; affx:commonToAll "1" . :Gene4921_e16 a affx:Exon ; affx:startsAt "29977367" ; affx:stopsAt "29977451" ; affx:commonToAll "1" . :Gene4921_e17 a affx:Exon ; affx:startsAt "29992918" ; affx:stopsAt "29992960" ; affx:commonToAll "1" . :Gene4921_e18 a affx:Exon ; affx:startsAt "29994703" ; affx:stopsAt "29994838" ; affx:commonToAll "1" . :Gene4921_e19 a affx:Exon ; affx:startsAt "29995273" ; affx:stopsAt "29995661" ; affx:commonToAll "1" . :Gene4922 a affx:Gene ; affx:strand "+" ; affx:chr "chr5" ; affx:hasVariant [affx:representedBy :gi15214783] . :gi15214783 a affx:Transcript ; affx:unigene "iMm.200763" ; affx:translatesTo "MAAAVAGPLAAGGEEAAASVSLPGSPGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLKCLNPALGNLTALTYLNLSRNQLSSLPPYICQLPLRVLIISNNKLGALPPDISTLGSLRQLDVSSNELQSLPVELCSLRSLRDLNVRRNQLSTLPDELGDLPLVRLDFSCNRISRIPVSFCRLRHLQVVLLDSNPLQSPPAQICLKGKLHIFKYLTMEAGRRGAALGDLVPSRPPSFSPCPAEDLFPGRRYDGGLDSGFHSVDSGSKRWSGNESTDDFSELSFRISELARDPRGPRQPREDGAGDGDLEQIDFIDSHVPGEDEDRSAAEEQLPSELSLVAGDVEKPSSSRREEPAGEERRRPDTLQLWQERERKQQQQSGGWGSPRKDSVLKRGIRAAGAGASAPSTQATCNGPPKSSTTQLGVSGGQGAPTPPPTSQDPLPVSGPVTAPVPRPLGSIQRPNSFLFRSSSQSGSSPSSPESVLRPRPFPQEKELISQLRQVLESRLQQPLPEDLAEALANGVLLCQLANQLRPRSVPFIHVPSPAVPKLSALKSRKNVESFLEACRKMGVPEADLCSPSDLLRGTAQGLQTVLEAVILVGGKAPLPVQPSSGLGGFLLFYVVFMLLLYVVYTRLLGS" ; affx:hasCds [affx:startsAt "136345710" ; affx:stopsAt "136356649" ]; affx:hasExon [ affx:relatesToExon :Gene4922_e1; affx:cdsType "Partial" ; affx:cdsStart "136345710" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e2; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e3; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e4; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e5; affx:cdsType "Full" ; affx:frame "0"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e6; affx:cdsType "Full" ; affx:frame "2"] ; affx:hasExon [ affx:relatesToExon :Gene4922_e7; affx:cds